Structure of the ICAM-1-binding PfEMP1 IT4var13 DBLbeta domain. Determined by X-ray diffraction at 2.17 Å resolution. Released 25 Sept 2019.
Explore 6S8T in 3D Show helices and sheets RCSB PDB PDBe
6S8T contains 23 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 744-746 | 3 | |
| α-helix | 748-764 | 17 | |
| α-helix | 769-771 | 3 | |
| α-helix | 775-777 | 3 | |
| α-helix | 792-794 | 3 | |
| β-strand | 802 | 1 | 1 |
| α-helix | 826-828 | 3 | |
| β-strand | 829-830 | 2 | 2 |
| β-strand | 842-843 | 2 | 2 |
| α-helix | 844 | 1 | |
| α-helix | 845-848 | 4 | |
| α-helix | 853-856 | 4 | |
| β-strand | 858 | 1 | 1 |
| α-helix | 860-864 | 5 | |
| α-helix | 869-895 | 27 | |
| α-helix | 904-926 | 23 | |
| α-helix | 934-953 | 20 | |
| α-helix | 970-972 | 3 | |
| α-helix | 978-1000 | 23 | |
| α-helix | 1008-1010 | 3 | |
| α-helix | 1020-1022 | 3 | |
| α-helix | 1025-1051 | 27 | |
| α-helix | 1067-1104 | 38 | |
| α-helix | 1120-1134 | 15 | |
| α-helix | 1145-1147 | 3 | |
| α-helix | 1149-1156 | 8 | |
| β-strand | 1167 | 1 | 3 |
| β-strand | 1185 | 1 | 3 |
| α-helix | 1197-1199 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Erythrocyte membrane protein 1 | A | protein | 469 | Plasmodium falciparum | E0A3B3 |
>6S8T_1 Erythrocyte membrane protein 1 (chains A) PCVVGGQADTIYPAIANQMAHQMHEDAQTEASKRGLAKLRADAKQGIYKKNRKPQELSNI CNITLQHSNDSRNGNNGGACTGKDGNNERFKIGTEWKIGEKVETTDTDAYIPPRRQHMCT SNLENLNVSWVTEDGKAIHSLLGDVQLAAKMDADEIIKRYKKHNTLTDPIQQKDQESICR AVRYSFADLGDIIRGRDLWEHGDQTKLQGHLQIIFGKIKEEIKKKHPGINGNDKYKGDEK NNPPYKQLREDWWEANRHQVWRAMQCELKNLKKSNGDCHYNSRGTPLDDYIPQRLRWMVE WAEWFCKMQSQEYDKLMKQCSQCMSKGGDCRKGDVNCTSCEQACEEYKKKIKKWEKQWNK IKDKYEELYLQAKIAFAGTSFGGGDRDYQQMVHFFKELQKVTGDTTLGDTTSPYSTAAGY IHQEGHVDECTEQTQFCKNRNGNTASGKEDDNYTFKDPPPKYANACKCD
Structural insights into diverse modes of ICAM-1 binding byPlasmodium falciparum-infected erythrocytes. Lennartz, F., Smith, C., Craig, A.G. et al. Proc Natl Acad Sci U S A (2019) 116:20124-20134. DOI 10.1073/pnas.1911900116 · PubMed
Other PDB entries of the same protein (UniProt E0A3B3), best resolution first:
MolViewer shows 6S8T directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.