6SKU: Legionella effector AnkX

Legionella effector AnkX in complex with human Rab1b. Determined by X-ray diffraction at 3.2 Å resolution. Released 10 Jun 2020.

Method: X-ray diffraction
Resolution: 3.2 Å
Organisms: Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513), Homo sapiens
Chains: 2
Atoms: 7,557
Mol. weight: 110.88 kDa
Ligands: MG, GDP
Released: 10 Jun 2020

Explore 6SKU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6SKU contains 63 α-helices and 19 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 55 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	12-16	5
α-helix	19-21	3
α-helix	23-25	3
α-helix	29-32	4
α-helix	39-44	6
α-helix	48-62	15
α-helix	74-82	9
β-strand	106-108	3	1
α-helix	111-113	3
β-strand	114	1	2
α-helix	116-124	9
α-helix	126-131	6
β-strand	135-137	3	1
β-strand	138-139	2	3
β-strand	146-147	2	3
α-helix	160-174	15
β-strand	181-184	4	1
α-helix	185-186	2
α-helix	190-207	18
α-helix	213-228	16
α-helix	235-238	4
α-helix	239-243	5
α-helix	244-250	7
β-strand	266	1	2
α-helix	269-292	24
α-helix	294-296	3
α-helix	305-312	8
α-helix	318-321	4
α-helix	334-343	10
α-helix	352-359	8
α-helix	363-370	8
α-helix	375-378	4
α-helix	382-383	2
α-helix	395-401	7
α-helix	405-413	9
α-helix	428-434	7
α-helix	438-450	13
α-helix	454-458	5
β-strand	461	1	4
β-strand	467	1	4
α-helix	468-474	7
α-helix	478-485	8
β-strand	495	1	5
β-strand	501	1	5
α-helix	502-508	7
α-helix	512-520	9
α-helix	523-525	3
α-helix	527-536	10
α-helix	539-549	11
α-helix	556-564	9
α-helix	568-577	10
α-helix	592-598	7
α-helix	602-610	9
α-helix	625-628	4
α-helix	629-631	3
α-helix	634-647	14
α-helix	662-668	7
α-helix	672-680	9
α-helix	695-699	5
α-helix	706-715	10
α-helix	728-734	7
α-helix	743-757	15
α-helix	758-760	3
β-strand	766	1	6
β-strand	773	1	6
α-helix	774-781	8
α-helix	787-793	7
α-helix	796-799	4

Chain B: 8 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	8-13	6	7
α-helix	20-28	9
α-helix	38-41	4
β-strand	44-50	7	7
β-strand	55-62	8	7
β-strand	82-88	7	7
α-helix	92-96	5
α-helix	98-102	5
α-helix	104-108	5
β-strand	114-120	7	7
α-helix	125-127	3
α-helix	132-141	10
β-strand	146-148	3	7
α-helix	157-171	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Phosphocholine transferase AnkX	A	protein	803	Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)	Q5ZXN6 (AlphaFold model)
Ras-related protein Rab-1B	B	protein	175	Homo sapiens	Q9H0U4 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6SKU_1 Phosphocholine transferase AnkX (chains A)
GHMMVKIMPNLPGLYFLQAYPSEEIWRLFVDGRFWSKENGWRGYESREPGSLNAALESLC
SIALQVEKSGEEFELSVDLIKRIHKKSGKKVEELQEKNPGELRTDEPVSFCIPAGRASIK
GIEEFLSLVFLTEGGAEFGPGKAGPFGPRFDKNYFKNLNPEQIPDLAKQIYFDMSKYGHS
NTNHFYLAVMKNVDVYLEKITQSYNKEIKTAETLDEKLKIIVKHIRMYEVLHPFRDANGR
TFVNNLLNILLMQQGLPPATFYEPNVFDLYSAEELVVVVKEAIFNTVEIIEQSKRKTPIT
LYGYHSSLEEQTKFRDMLDSPSYEKIKHMDFSDLNPEKLHLKTQKCLSSLNEQYPLHRGA
IYLSDPGEIKLLLSNRNESQINQQIEQGAPPIYVGKTPAHLAVISGNMAMLDELIAKKAD
LSLQDYDGKTALHYAAECGNMQIMGKILKVVLSQEDAIKVLNIKDNHGKTAFHYAAEFGT
PELISALTTTEVIQINEPDNSGSSAITLAYKNHKLKIFDELLNSGADISDELLDAIWARK
DKETLGKIIAKNEKILLNKEAFRIAISLGSVSLVKKFLRAGVDIDIPLTKDKATPLMLSI
NSGNPKLVSYLLKKGANTRLTDTSGNSVLHYVFYSKAENREALANIITEKDKKLINQPNA
NGNPPLYNAVVVNDLKMATILLEMGARVDFEDRLGNNILHSAMRRCDLPIILDIVKKDST
LLHKRNSERRNPFHQALHEMHTFPSSKETEEIHFMNLSDLLLKEGVDLNKKDIKGKTILD
IALSKQYFHLCVKLMKAGAHTNI

Sequence of entity 2 (B), FASTA

>6SKU_2 Ras-related protein Rab-1B (chains B)
GPMPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKL
QIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLV
GNKSDLTTKKVVDNTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMG

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1
GDP	Guanosine-5'-diphosphate	C10 H15 N5 O11 P2	1

Primary citation

Legionellaeffector AnkX displaces the switch II region for Rab1b phosphocholination. Ernst, S., Ecker, F., Kaspers, M.S. et al. Sci Adv (2020) 6:eaaz8041-eaaz8041. DOI 10.1126/sciadv.aaz8041 · PubMed

Other PDB entries of the same protein (UniProt Q5ZXN6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4BES 2.54 Å, Crystal structure of the Legionella pneumophila FIC domain-containing effector AnkX…
4BET 2.55 Å, Crystal structure of the Legionella pneumophila FIC domain-containing effector AnkX…
4BER 2.6 Å, Crystal structure of the Legionella pneumophila FIC domain-containing effector AnkX…
4BEP 3.14 Å, Crystal structure of the Legionella pneumophila FIC domain-containing effector AnkX…

Browse structure collections

About this viewer

MolViewer shows 6SKU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.