6SLM: Full-length HPV31 E6 oncoprotein

Name: PDB 6SLM: Crystal structure of full-length HPV31 E6 oncoprotein in complex with LXXLL peptide of ubiquitin ligase E6AP
Published: 2020-09-09
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: oncoprotein

Crystal structure of full-length HPV31 E6 oncoprotein in complex with LXXLL peptide of ubiquitin ligase E6AP. Determined by X-ray diffraction at 2.8 Å resolution. Released 9 Sept 2020.

Method: X-ray diffraction
Resolution: 2.8 Å
Organisms: Escherichia coli (strain K12), Human papillomavirus type 31, Homo sapiens
Chains: 1
Atoms: 4,281
Mol. weight: 61.62 kDa
Ligands: ZN
Released: 9 Sept 2020

Explore 6SLM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6SLM contains 36 α-helices and 33 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 36 helices, 33 β-strands

Element	Residues	Length	Sheet
β-strand	637-640	4	1
α-helix	647-661	15
β-strand	665-668	4	1
α-helix	673-681	9
β-strand	689-693	5	1
α-helix	694-696	3
α-helix	697-702	6
β-strand	706	1	2
α-helix	707-708	2
β-strand	719	1	3
α-helix	721-725	5
β-strand	728-729	2	4
β-strand	732-733	2	4
β-strand	736-741	6	1
β-strand	744-748	5	5
β-strand	758	1	6
α-helix	762-770	9
β-strand	775-777	3	5
α-helix	784-791	8
β-strand	797-802	6	7
β-strand	805-812	8	7
α-helix	816-830	15
α-helix	840-848	9
β-strand	852-857	6	5
α-helix	859-861	3
α-helix	862-867	6
β-strand	872-875	4	5
α-helix	876-878	3
β-strand	879	1	6
β-strand	880	1	8
β-strand	883	1	8
α-helix	884-885	2
β-strand	888-889	2	9
β-strand	890-896	7	1
β-strand	897	1	2
α-helix	905-909	5
α-helix	910-914	5
α-helix	917-926	10
β-strand	931-932	2	1
β-strand	934	1	3
α-helix	935-940	6
α-helix	945-956	12
β-strand	958-959	2	9
α-helix	960-961	2
α-helix	966-981	16
α-helix	987-997	11
α-helix	1012-1019	8
α-helix	1023-1025	3
β-strand	1029-1030	2	10
α-helix	1035	1
β-strand	1036	1	10
α-helix	1037	1
α-helix	1039-1047	9
α-helix	1050-1052	3
β-strand	1053-1055	3	10
β-strand	1058-1061	4	10
α-helix	1064-1077	14
β-strand	1079-1083	5	11
α-helix	1085-1092	8
α-helix	1096-1098	3
β-strand	1102-1103	2	11
α-helix	1108	1
β-strand	1109	1	11
α-helix	1110-1111	2
α-helix	1112-1121	10
β-strand	1125-1128	4	11
β-strand	1131-1134	4	11
α-helix	1147-1149	3
α-helix	1167-1176	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Maltose/maltodextrin-binding periplasmic protein,Protein E6,Ubiquitin-protein ligase E3A	A	protein	551	Escherichia coli (strain K12), Human papillomavirus type 31, Homo sapiens	P0AEX9 (AlphaFold model), P17386 (AlphaFold model), Q05086 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6SLM_1 Maltose/maltodextrin-binding periplasmic protein,Protein E6,Ubiquitin-protein ligase E3A (chains A)
MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDI
IFWAHDRFGGYAQSGLLAEITPAAAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNK
DLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIK
DVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSA
VNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPL
GAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDA
ALAAAQTNAAAMFKNPAERPRKLHELSSALEIPYDELRLNCVYCKGQLTETEVLDFAFTD
LTIVYRDDTPHGVCTKCLRFYSKVSEFRWYRYSVYGTTLEKLTNKGISDLLIRCITCQRP
LSPEEKQRHLDKKKRFHNIGGRWTGRCIACWRRPRTETQVGSSGSGSGSGSGSAAAESSE
LTLQELLGEER

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Water and common crystallization additives (GOL) are not listed.

Primary citation

Structure of High-Risk Papillomavirus 31 E6 Oncogenic Protein and Characterization of E6/E6AP/p53 Complex Formation. Conrady, M.C., Suarez, I., Gogl, G. et al. J Virol (2020) 95. DOI 10.1128/JVI.00730-20 · PubMed

Other PDB entries of the same protein (UniProt P0AEX9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8C8F 1.15 Å, Crystal structure of the E. coli maltodextrin-binding protein
4EXK 1.28 Å, A chimera protein containing MBP fused to the C-terminal domain of the uncharacterized…
3Q27 1.3 Å, Cyrstal structure of human alpha-synuclein (32-57) fused to maltose binding protein (MBP)
7KD4 1.31 Å, Structure of the C-terminal domain of the Menangle virus phosphoprotein (residues 329…
5M13 1.37 Å, Synthetic nanobody in complex with MBP
5HZ7 1.43 Å, High-resolution crystal structure of the minor DNA-binding pilin ComP from Neisseria…
5H7Q 1.45 Å, Crystal structure of human MNDA PYD domain with MBP tag
6XDS 1.47 Å, Crystal structure of MBP-TREM2 Ig domain fusion with fragment,…
4IRL 1.47 Å, X-ray structure of the CARD domain of zebrafish GBP-NLRP1 like protein
8SVY 1.47 Å, MBP-Mcl1 in complex with ligand 10
3MP6 1.48 Å, Complex Structure of Sgf29 and dimethylated H3K4
9CLC 1.48 Å, Crystal structure of maltose binding protein (Apo), mutant Trp10 to 4-Cyanotryptophan

Browse structure collections

About this viewer

MolViewer shows 6SLM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.