6SM1: Wild type immunoglobulin light chain

Wild type immunoglobulin light chain (WT-1). Determined by X-ray diffraction at 1.55 Å resolution. Released 18 Mar 2020.

Method: X-ray diffraction
Resolution: 1.55 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,025
Mol. weight: 12.37 kDa
Ligands: CA
Released: 18 Mar 2020

Explore 6SM1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6SM1 contains 3 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	5	1
β-strand	6	1	1
β-strand	7	1	2
β-strand	11-14	4	3
β-strand	20-25	6	2
β-strand	37-42	6	3
β-strand	49-52	4	3
β-strand	53	1	4
β-strand	57	1	4
α-helix	58-59	2
β-strand	66-71	6	2
β-strand	74-79	6	2
α-helix	84-86	3
β-strand	88-95	8	3
β-strand	102-104	3	3
β-strand	105	1	1
β-strand	108-112	5	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Immunoglobulin lambda variable 2-14	A	protein	114	Homo sapiens	P01704 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6SM1_1 Immunoglobulin lambda variable 2-14 (chains A)
MGQSALTQPASVSGSPGQSITISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIYEVSNRPS
GVSNRFSGSKSGNTASLTISGLQAEDEADYYCSSYTSSSTLYVFGTGTKVTVLG

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	1

Water and common crystallization additives (PEG, PGE) are not listed.

Primary citation

Fatal amyloid formation in a patient's antibody light chain is caused by a single point mutation. Kazman, P., Vielberg, M.T., Pulido Cendales, M.D. et al. Elife (2020) 9. DOI 10.7554/eLife.52300 · PubMed

Other PDB entries of the same protein (UniProt P01704 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5C6W 1.54 Å, anti-CXCL13 scFv - E10
5CBE 2.4 Å, E10 in complex with CXCL13
5CBA 2.5 Å, 3B4 in complex with CXCL13 - 3B4-CXCL13
9N7T 3.01 Å, H5 hemagglutinin (A/Jiangsu/NJ210/2023) in complex with central stem-targeting Fab ST14

Browse structure collections

About this viewer

MolViewer shows 6SM1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.