6SMV: HPV49 E6 protein

Structure of HPV49 E6 protein in complex with MAML1 LxxLL motif. Determined by X-ray diffraction at 2.14 Å resolution. Released 4 Sept 2019.

Method: X-ray diffraction
Resolution: 2.14 Å
Organisms: Escherichia coli (strain K12), Human papillomavirus type 49, Homo sapiens
Chains: 1
Atoms: 4,298
Mol. weight: 60.17 kDa
Ligands: ZN
Released: 4 Sept 2019

Explore 6SMV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6SMV contains 34 α-helices and 34 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 34 helices, 34 β-strands

Element	Residues	Length	Sheet
α-helix	2-4	3
β-strand	8-11	4	1
α-helix	18-32	15
β-strand	36-39	4	1
α-helix	44-52	9
β-strand	60-64	5	1
α-helix	68-73	6
β-strand	77	1	2
α-helix	78-80	3
α-helix	84-87	4
β-strand	90	1	3
α-helix	92-96	5
β-strand	99	1	4
β-strand	104	1	4
β-strand	107-112	6	1
β-strand	115-119	5	5
β-strand	129	1	6
α-helix	130-132	3
α-helix	133-142	10
β-strand	146-148	3	5
α-helix	155-162	8
α-helix	163-165	3
β-strand	168-170	3	7
β-strand	182-183	2	7
α-helix	187-201	15
α-helix	211-218	8
β-strand	223-228	6	5
α-helix	230-232	3
α-helix	233-238	6
β-strand	243-246	4	5
α-helix	247-249	3
β-strand	250-251	2	6
β-strand	254-255	2	6
α-helix	256	1
β-strand	259-260	2	8
β-strand	261-267	7	1
β-strand	268	1	2
α-helix	274-282	9
α-helix	288-297	10
β-strand	302-303	2	1
β-strand	305	1	3
α-helix	306-309	4
α-helix	316-327	12
β-strand	329-330	2	8
α-helix	331-332	2
α-helix	337-352	16
α-helix	358-1001	15
α-helix	1007-1013	7
α-helix	1018-1020	3
β-strand	1024	1	9
β-strand	1025	1	10
β-strand	1031	1	9
α-helix	1034-1042	9
β-strand	1048-1050	3	11
β-strand	1053-1055	3	11
β-strand	1056	1	10
α-helix	1059-1072	14
β-strand	1074-1079	6	12
α-helix	1080-1082	3
α-helix	1083-1087	5
β-strand	1096-1098	3	12
α-helix	1103	1
β-strand	1104	1	12
α-helix	1105-1106	2
α-helix	1107-1115	9
β-strand	1119-1123	5	12
β-strand	1126-1129	4	12
α-helix	1999-2012	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Maltose/maltodextrin-binding periplasmic protein,Protein E6,Mastermind-like protein 1	A	protein	538	Escherichia coli (strain K12), Human papillomavirus type 49, Homo sapiens	P0AEX9 (AlphaFold model), P36813 (AlphaFold model), Q92585 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6SMV_1 Maltose/maltodextrin-binding periplasmic protein,Protein E6,Mastermind-like protein 1 (chains A)
MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDI
IFWAHDRFGGYAQSGLLAEITPAAAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNK
DLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIK
DVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSA
VNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPL
GAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDA
ALAAAQTNAAAMARPVKVAELAHHLNIPIWEVLLPCNFCTGFLTYQELLEFDYKDFNLLW
KDGFVFGCCAACAYRSAYHEFTNYHQEIVVGIEIEGRAAANIAEIVVRCLICLKRLDLLE
KLDICAQHREFHRVRNRWKGVCRHCRVIEGSGSGSGSGSGSAAAEEWMSDLDDLLGSQ

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Water and common crystallization additives (PEG) are not listed.

Primary citation

Cellular target recognition by HPV18 and HPV49 oncoproteins. Suarez, I.P., Bonhoure, A., Cousido-Siah, A. et al. To be published.

Other PDB entries of the same protein (UniProt P0AEX9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8C8F 1.15 Å, Crystal structure of the E. coli maltodextrin-binding protein
4EXK 1.28 Å, A chimera protein containing MBP fused to the C-terminal domain of the uncharacterized…
3Q27 1.3 Å, Cyrstal structure of human alpha-synuclein (32-57) fused to maltose binding protein (MBP)
7KD4 1.31 Å, Structure of the C-terminal domain of the Menangle virus phosphoprotein (residues 329…
5M13 1.37 Å, Synthetic nanobody in complex with MBP
5HZ7 1.43 Å, High-resolution crystal structure of the minor DNA-binding pilin ComP from Neisseria…
5H7Q 1.45 Å, Crystal structure of human MNDA PYD domain with MBP tag
6XDS 1.47 Å, Crystal structure of MBP-TREM2 Ig domain fusion with fragment,…
4IRL 1.47 Å, X-ray structure of the CARD domain of zebrafish GBP-NLRP1 like protein
8SVY 1.47 Å, MBP-Mcl1 in complex with ligand 10
3MP6 1.48 Å, Complex Structure of Sgf29 and dimethylated H3K4
9CLC 1.48 Å, Crystal structure of maltose binding protein (Apo), mutant Trp10 to 4-Cyanotryptophan

Browse structure collections

About this viewer

MolViewer shows 6SMV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.