6SQP: Cat MDM2-S429E RING domain homodimer

Crystal structure of Cat MDM2-S429E RING domain homodimer. Determined by X-ray diffraction at 1.21 Å resolution. Released 6 May 2020.

Method: X-ray diffraction
Resolution: 1.21 Å
Organism: Felis catus
Chains: 4
Atoms: 2,302
Mol. weight: 30.63 kDa
Ligands: ZN
Released: 6 May 2020

Explore 6SQP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6SQP contains 12 α-helices and 12 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	432-435	4
β-strand	448-452	5	1
β-strand	455-457	3	1
α-helix	462-470	9
α-helix	473-475	3
α-helix	480-482	3
β-strand	484-489	6	1

Chain B: 3 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	432-435	4
β-strand	448-452	5	1
β-strand	455-457	3	1
α-helix	462-470	9
α-helix	473-475	3
β-strand	484-489	6	1

Chain C: 3 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	433-435	3
β-strand	448-452	5	2
β-strand	455-457	3	2
α-helix	462-470	9
α-helix	480-482	3
β-strand	484-489	6	2

Chain D: 2 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	432-435	4
β-strand	448-452	5	2
β-strand	455-460	6	2
α-helix	462-470	9
β-strand	484-489	6	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin-protein ligase Mdm2	A	protein	63	Felis catus	Q7YRZ8 (AlphaFold model)
E3 ubiquitin-protein ligase Mdm2	B, D	protein	68	Felis catus	Q7YRZ8 (AlphaFold model)
E3 ubiquitin-protein ligase Mdm2	C	protein	65	Felis catus	Q7YRZ8 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6SQP_1 E3 ubiquitin-protein ligase Mdm2 (chains A)
EFPHNAIEPCVICQTRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQPIQMIVLT
YFP

Sequence of entity 2 (B, D), FASTA

>6SQP_2 E3 ubiquitin-protein ligase Mdm2 (chains B, D)
EIVEPEFPHNAIEPCVICQTRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQPIQ
MIVLTYFP

Sequence of entity 3 (C), FASTA

>6SQP_3 E3 ubiquitin-protein ligase Mdm2 (chains C)
EPEFPHNAIEPCVICQTRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQPIQMIV
LTYFP

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	8

Water and common crystallization additives (NO3, CL) are not listed.

Primary citation

Structural basis for DNA damage-induced phosphoregulation of MDM2 RING domain. Magnussen, H.M., Ahmed, S.F., Sibbet, G.J. et al. Nat Commun (2020) 11:2094-2094. DOI 10.1038/s41467-020-15783-y · PubMed

Other PDB entries of the same protein (UniProt Q7YRZ8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6SQS 1.83 Å, Crystal structure of cat phospho-Ser429 MDM2 RING domain bound to UbcH5B-Ub
6SQR 2.18 Å, Crystal structure of Cat MDM2-S429E RING domain bound to UbcH5B-Ub

Browse structure collections

About this viewer

MolViewer shows 6SQP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.