6STF: Human Rab8a phosphorylated at Ser111

Human Rab8a phosphorylated at Ser111 in complex with GDP. Determined by X-ray diffraction at 2.4 Å resolution. Released 22 Apr 2020.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Homo sapiens
Chains: 5
Atoms: 6,875
Mol. weight: 105.97 kDa
Ligands: MG, GDP
Released: 22 Apr 2020

Explore 6STF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6STF contains 32 α-helices and 42 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	7-14	8	1
α-helix	21-30	10
β-strand	45-52	8	1
β-strand	55-62	8	1
α-helix	68-70	3
α-helix	75-78	4
β-strand	83-89	7	1
α-helix	93-97	5
α-helix	99-109	11
β-strand	115-121	7	1
α-helix	133-142	10
β-strand	146-149	4	1
β-strand	151	1	2
β-strand	156	1	2
α-helix	158-177	20

Chain B: 7 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	7-14	8	3
α-helix	21-30	10
β-strand	45-52	8	3
β-strand	55-62	8	3
α-helix	75-78	4
β-strand	83-89	7	3
α-helix	93-97	5
α-helix	99-109	11
β-strand	115-121	7	3
α-helix	126-128	3
α-helix	133-142	10
β-strand	146-149	4	3
β-strand	151	1	4
β-strand	156	1	4
α-helix	158-176	19

Chain C: 6 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	7-14	8	5
α-helix	21-30	10
β-strand	33	1	6
β-strand	45-52	8	5
β-strand	55-62	8	5
β-strand	81-89	9	5
α-helix	93-97	5
α-helix	99-109	11
β-strand	115-121	7	5
α-helix	126-128	3
α-helix	133-142	10
β-strand	146-149	4	5
β-strand	151	1	7
β-strand	156	1	7
α-helix	158-175	18

Chain D: 6 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	8-14	7	8
α-helix	21-30	10
β-strand	45-52	8	8
β-strand	55-63	9	8
β-strand	83-89	7	8
α-helix	93-97	5
α-helix	99-108	10
β-strand	115-121	7	8
α-helix	126-128	3
α-helix	133-142	10
β-strand	146-149	4	8
β-strand	151	1	6
β-strand	156	1	6
α-helix	158-174	17

Chain E: 6 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	7-14	8	9
α-helix	21-30	10
β-strand	33	1	4
β-strand	45-52	8	9
β-strand	55-63	9	9
β-strand	81-89	9	9
α-helix	93-97	5
α-helix	99-109	11
β-strand	115-121	7	9
α-helix	126-128	3
α-helix	133-142	10
β-strand	146-149	4	9
β-strand	151	1	10
β-strand	156	1	10
α-helix	158-176	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ras-related protein Rab-8A	A, B, C, D, E	protein	178	Homo sapiens	P61006 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E), FASTA

>6STF_1 Ras-related protein Rab-8A (chains A, B, C, D, E)
MDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDT
AGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCD
VNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	5
GDP	Guanosine-5'-diphosphate	C10 H15 N5 O11 P2	5

Primary citation

PINK1-dependent phosphorylation of Serine111 within the SF3 motif of Rab GTPases impairs effector interactions and LRRK2-mediated phosphorylation at Threonine72. Vieweg, S., Mulholland, K., Brauning, B. et al. Biochem J (2020) 477:1651-1668. DOI 10.1042/BCJ20190664 · PubMed

Other PDB entries of the same protein (UniProt P61006 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4LHW 1.55 Å, Crystal structure of Rab8 in its active GppNHp-bound form
6SQ2 1.68 Å, Structure of a phosphomimetic switch 2 variant of Rab8a in complex with the phospho-Rab…
6WHE 1.73 Å, Structure of phosphomimetic Rab8a GTPase (T72E) in the GTP-bound state
6RIR 1.77 Å, Crystal structure of phosphorylated Rab8a in complex with the Rab-binding domain of RILPL2
9M0O 1.83 Å, Crystal structure of OPTN 138-170 in complex with GTP-bound RAB8A1-176 (Q67L)
7LWB 1.9 Å, Crystal Structure of phospho-Rab8a with the RH2 domain (117-165) of RILPL2
6ZSI 1.91 Å, The mechanism of activation of the actin binding protein EHBP1 by Rab8 family members.
9IKQ 1.93 Å, Crystal structure of OPTN LZD in complex with GTP-bound Rab8a(Q67L)
4LHV 1.95 Å, Crystal structure of Rab8 in its inactive GDP-bound form
3QBT 2.0 Å, Crystal structure of OCRL1 540-678 in complex with Rab8a:GppNHp
6ZSJ 2.0 Å, The mechanism of activation of the actin binding protein EHBP1 by Rab8 family members.
6YX5 2.14 Å, Structure of DrrA from Legionella pneumophilia in complex with human Rab8a

Browse structure collections

About this viewer

MolViewer shows 6STF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.