6SUQ: TcdB2-TccC3-TEV

Name: PDB 6SUQ: Crystal Structure of TcdB2-TccC3-TEV
Published: 2019-12-04
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: toxin

Crystal Structure of TcdB2-TccC3-TEV. Determined by X-ray diffraction at 3.7 Å resolution. Released 4 Dec 2019.

Method: X-ray diffraction
Resolution: 3.7 Å
Organisms: Photorhabdus luminescens, Tobacco etch virus
Chains: 1
Atoms: 17,025
Mol. weight: 272.97 kDa
Released: 4 Dec 2019

Explore 6SUQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6SUQ contains 51 α-helices and 163 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 51 helices, 163 β-strands

Element	Residues	Length	Sheet
α-helix	21-23	3
α-helix	27-29	3
β-strand	38-42	5	1
β-strand	56-60	5	1
β-strand	72-73	2	1
β-strand	80-81	2	2
β-strand	96-97	2	2
β-strand	103	1	2
β-strand	104-116	13	3
β-strand	119-132	14	3
β-strand	134	1	4
β-strand	140-146	7	3
β-strand	154-158	5	3
β-strand	161	1	4
β-strand	164-167	4	3
α-helix	171-173	3
β-strand	175-176	2	2
β-strand	184-186	3	2
β-strand	189-193	5	3
β-strand	199-206	8	3
α-helix	214-219	6
β-strand	227-236	10	3
α-helix	243	1
α-helix	249-251	3
α-helix	253-255	3
β-strand	256-263	8	3
β-strand	290-291	2	5
β-strand	300-301	2	5
β-strand	307-312	6	3
α-helix	314-317	4
β-strand	328-338	11	3
β-strand	345-354	10	3
β-strand	360-362	3	3
α-helix	363-365	3
β-strand	366	1	3
β-strand	367-370	4	4
β-strand	382-383	2	6
α-helix	385-388	4
β-strand	397-399	3	7
β-strand	408-413	6	7
β-strand	416-420	5	7
β-strand	422-424	3	8
β-strand	433-435	3	8
β-strand	439	1	7
α-helix	445-447	3
β-strand	452-454	3	9
β-strand	464-467	4	9
β-strand	485-488	4	9
α-helix	489-491	3
α-helix	494-496	3
α-helix	501-507	7
β-strand	511-516	6	10
β-strand	522-526	5	10
α-helix	527-528	2
β-strand	538-539	2	11
β-strand	546-547	2	11
β-strand	556-559	4	10
β-strand	570-573	4	10
β-strand	578-581	4	10
β-strand	583-585	3	12
β-strand	588-589	2	12
β-strand	593-595	3	10
α-helix	607-609	3
β-strand	610-613	4	13
β-strand	622-626	5	13
β-strand	630-634	5	13
β-strand	636	1	14
β-strand	642	1	14
β-strand	646-649	4	13
α-helix	650	1
β-strand	661-665	5	6
β-strand	674-678	5	6
β-strand	686-689	4	6
β-strand	699-703	5	4
β-strand	708-716	9	4
α-helix	717-730	14
β-strand	744-753	10	4
β-strand	759-767	9	4
β-strand	772	1	15
β-strand	777	1	15
β-strand	783-788	6	4
β-strand	791	1	4
α-helix	792-793	2
α-helix	800-803	4
β-strand	804-811	8	4
α-helix	815-820	6
α-helix	831-835	5
β-strand	838-842	5	4
β-strand	847-849	3	4
α-helix	855-864	10
β-strand	868-876	9	4
β-strand	886-900	15	4
β-strand	908-920	13	4
β-strand	929-938	10	4
β-strand	944-951	8	4
α-helix	952-958	7
α-helix	971-974	4
β-strand	982-996	15	4
β-strand	1001-1017	17	4
α-helix	1018-1020	3
α-helix	1028-1031	4
β-strand	1045-1055	11	4
β-strand	1071-1080	10	4
α-helix	1082-1085	4
α-helix	1086-1088	3
α-helix	1095-1104	10
β-strand	1107-1109	3	4
α-helix	1110-1111	2
β-strand	1121-1126	6	4
β-strand	1128-1131	4	16
α-helix	1134-1136	3
β-strand	1140-1144	5	16
β-strand	1152-1156	5	16
β-strand	1163-1167	5	16
β-strand	1173-1179	7	16
β-strand	1184-1189	6	16
β-strand	1195-1200	6	16
β-strand	1206-1215	10	16
β-strand	1218-1221	4	16
α-helix	1223-1224	2
α-helix	1231-1233	3
α-helix	1236-1240	5
β-strand	1250-1255	6	16
α-helix	1265-1270	6
α-helix	1273-1281	9
β-strand	1285	1	17
β-strand	1291	1	17
α-helix	1293-1301	9
β-strand	1322-1328	7	16
β-strand	1339-1345	7	16
β-strand	1354-1357	4	16
β-strand	1362-1364	3	18
β-strand	1365	1	19
β-strand	1366-1367	2	18
β-strand	1373-1380	8	18
β-strand	1385-1387	3	16
β-strand	1390-1392	3	20
β-strand	1398-1402	5	20
β-strand	1405-1406	2	16
β-strand	1407	1	19
α-helix	1411-1414	4
β-strand	1426-1431	6	20
β-strand	1437-1441	5	20
β-strand	1447-1452	6	20
β-strand	1456-1460	5	20
β-strand	1493-1497	5	20
β-strand	1503-1510	8	20
α-helix	1517-1518	2
β-strand	1519-1527	9	20
β-strand	1533-1537	5	20
α-helix	1539-1545	7
β-strand	1555-1559	5	20
β-strand	1565-1570	6	20
β-strand	1574-1580	7	20
β-strand	1586-1590	5	20
β-strand	1596-1601	6	20
β-strand	1610-1616	7	20
β-strand	1624-1631	8	20
α-helix	1636-1640	5
β-strand	1647-1651	5	20
β-strand	1655-1662	8	20
β-strand	1668-1676	9	20
α-helix	1690-1693	4
β-strand	1696-1707	12	20
β-strand	1713-1717	5	20
β-strand	1723-1728	6	20
β-strand	1734-1740	7	20
β-strand	1746-1755	10	20
β-strand	1761-1766	6	20
β-strand	1771-1777	7	20
β-strand	1782-1790	9	20
β-strand	1795-1804	10	20
β-strand	1810-1815	6	20
α-helix	1818-1819	2
α-helix	1830-1831	2
β-strand	1832-1833	2	20
β-strand	1834-1836	3	21
β-strand	1842-1845	4	21
β-strand	1848-1850	3	22
α-helix	1851-1853	3
β-strand	1864	1	23
β-strand	1872-1874	3	22
β-strand	1876-1881	6	21
β-strand	1887-1893	7	21
β-strand	1902-1904	3	21
β-strand	1905-1907	3	24
α-helix	1908	1
β-strand	1914-1916	3	24
α-helix	1923-1929	7
β-strand	1930	1	25
β-strand	1936	1	25
β-strand	1938-1940	3	26
β-strand	1943-1944	2	26
β-strand	1945-1947	3	23
β-strand	1953-1959	7	23
β-strand	1968-1974	7	23
β-strand	1980-1986	7	23
β-strand	1994-2001	8	23
β-strand	2004-2011	8	23
β-strand	2015-2024	10	23
β-strand	2032-2039	8	23
β-strand	2049-2055	7	23
β-strand	2061-2065	5	23
β-strand	2071-2077	7	23
β-strand	2083-2088	6	23
α-helix	2091-2094	4
β-strand	2099-2101	3	27
β-strand	2104-2105	2	27
β-strand	2106	1	28
α-helix	2107	1
β-strand	2112-2113	2	28
β-strand	2118-2120	3	28
β-strand	2125-2126	2	28
α-helix	2144-2146	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
TcdB2,TccC3,Genome polyprotein	A	protein	2410	Photorhabdus luminescens, Tobacco etch virus	P04517, Q8GF97 (AlphaFold model), Q8GF99

Sequence of entity 1 (A), FASTA

>6SUQ_1 TcdB2,TccC3,Genome polyprotein (chains A)
MQNSQDFSITELSLPKGGGAITGMGEALTPTGPDGMAALSLPLPISAGRGYAPAFTLNYN
SGAGNSPFGLGWDCNVMTIRRRTHFGVPHYDETDTFLGPEGEVLVVADQPRDESTLQGIN
LGATFTVTGYRSRLESHFSRLEYWQPKTTGKTDFWLIYSPDGQVHLLGKSPQARISNPSQ
TTQTAQWLLEASVSSRGEQIYYQYRAEDDTGCEADEITHHLQATAQRYLHIVYYGNRTAS
ETLPGLDGSAPSQADWLFYLVFDYGERSNNLKTPPAFSTTGSWLCRQDRFSRYEYGFEIR
TRRLCRQVLMYHHLQALDSKITEHNGPTLVSRLILNYDESAIASTLVFVRRVGHEQDGNV
VTLPPLELAYQDFSPRHHAHWQPMDVLANFNAIQRWQLVDLKGEGLPGLLYQDKGAWWYR
SAQRLGEIGSDAVTWEKMQPLSVIPSLQSNASLVDINGDGQLDWVITGPGLRGYHSQRPD
GSWTRFTPLNALPVEYTHPRAQLADLMGAGLSDLVLIGPKSVRLYANTRDGFAKGKDVVQ
SGDITLPVPGADPRKLVAFSDVLGSGQAHLVEVSATKVTCWPNLGRGRFGQPITLPGFSQ
PATEFNPAQVYLADLDGSGPTDLIYVHTNRLDIFLNKSGNGFAEPVTLRFPEGLRFDHTC
QLQMADVQGLGVASLILSVPHMSPHHWRCDLTNMKPWLLNEMNNNMGVHHTLRYRSSSQF
WLDEKAAALTTGQTPVCYLPFPIHTLWQTETEDEISGNKLVTTLRYARGAWDGREREFRG
FGYVEQTDSHQLAQGNAPERTPPALTKNWYATGLPVIDNALSTEYWRDDQAFAGFSPRFT
TWQDNKDVPLTPEDDNSRYWFNRALKGQLLRSELYGLDDSTNKHVPYTVTEFRSQVRRLQ
HTDSRYPVLWSSVVESRNYHYERIASDPQCSQNITLSSDRFGQPLKQLSVQYPRRQQPAI
NLYPDTLPDKLLANSYDDQQRQLRLTYQQSSWHHLTNNTVRVLGLPDSTRSDIFTYGAEN
VPAGGLNLELLSDKNSLIADDKPREYLGQQKTAYTDGQNTTPLQTPTRQALIAFTETTVF
NQSTLSAFNGSIPSDKLSTTLEQAGYQQTNYLFPRTGEDKVWVAHHGYTDYGTAAQFWRP
QKQSNTQLTGKITLIWDANYCVVVQTRDAAGLTTSAKYDWRFLTPVQLTDINDNQHLITL
DALGRPITLRFWGTENGKMTGYSSPEKASFSPPSDVNAAIELKKPLPVAQCQVYAPESWM
PVLSQKTFNRLAEQDWQKLYNARIITEDGRICTLAYRRWVQSQKAIPQLISLLNNGPRLP
PHSLTLTTDRYDHDPEQQIRQQVVFSDGFGRLLQAAARHEAGMARQRNEDGSLIINVQHT
ENRWAVTGRTEYDNKGQPIRTYQPYFLNDWRYVSNDSARQEKEAYADTHVYDPIGREIKV
ITAKGWFRRTLFTPWFTVNEDENDTAAEVKKVKMPGSRPMKNIDPKLYQKTPTVSVYDNR
GLIIRNIDFHRTTANGDPDTRITRHQYDIHGHLNQSIDPRLYEAKQTNNTIKPNFLWQYD
LTGNPLCTESIDAGRTVTLNDIEGRPLLTVTATGVIQTRQYETSSLPGRLLSVAEQTPEE
KTSRITERLIWAGNTEAEKDHNLAGQCVRHYDTAGVTRLESLSLTGTVLSQSSQLLIDTQ
EANWTGDNETVWQNMLADDIYTTLSTFDATGALLTQTDAKGNIQRLAYDVAGQLNGSWLT
LKGQTEQVIIKSLTYSAAGQKLREEHGNDVITEYSYEPETQRLIGIKTRRPSDTKVLQDL
RYEYDPVGNVISIRNDAEATRFWHNQKVMPENTYTYDSLYQLISATGREMANIGQQSHQF
PSPALPSDNNTYTNYTRTYTYDRGGNLTKIQHSSPATQNNYTTNITVSNRSNRAVLSTLT
EDPAQVDALFDAGGHQNTLISGQNLNWNTRGELQQVTLVKRDKGANDDREWYRYSGDGRR
MLKINEQQASNNAQTQRVTYLPNLELRLTQNSTATTEDLQVITVGEAGRAQVRVLHWESG
KPEDIDNNQLRYSYDNLIGSSQLELDSEGQIISEEEYYPYGGTALWAARNQTEASYKTIR
YSGKERDATGLYYYGYRYYQPWIGRWLSSDPAGTIDGLNLYRMVRNNPVTLLDPDGLMPE
FGESLFKGPRDYNPISSTICHLTNESDGHTTSLYGIGFGPFIITNKHLFRRNNGTLLVQS
LHGVFKVKNTTTLQQHLIDGRDMIIIRMPKDFPPFPQKLKFREPQREERICLVTTNFQTK
SMSSMVSDTSCTFPSSDGIFWKHWIQTKDGQCGSPLVSTRDGFIVGIHSASNFTNTNNYF
TSVPKNFMELLTNQEAQQWVSGWRLNADSVLWGGHKVFMVKPEEPFQPVKEATQLMNRRR
RRLEHHHHHH

Primary citation

Towards the application of Tc toxins as a universal protein translocation system. Roderer, D., Schubert, E., Sitsel, O. et al. Nat Commun (2019) 10:5263-5263. DOI 10.1038/s41467-019-13253-8 · PubMed

Other PDB entries of the same protein (UniProt P04517), best resolution first:

1LVM 1.8 Å, Catalytically active tobacco etch virus protease complexed with product
1LVB 2.2 Å, Catalytically inactive tobacco etch virus protease complexed with substrate
1Q31 2.7 Å, Crystal Structure of the Tobacco Etch Virus Protease C151A mutant
9R9W 3.34 Å, RNA-free helical (h8.5) virus-like particle composed of TEV coat protein

Browse structure collections

About this viewer

MolViewer shows 6SUQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.