Papain bound to a natural cysteine protease inhibitor from Streptomyces mobaraensis. Determined by X-ray diffraction at 1.65 Å resolution. Released 4 Dec 2019.
Explore 6TCX in 3D Show helices and sheets RCSB PDB PDBe
6TCX contains 10 α-helices and 17 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 5-6 | 2 | 1 |
| α-helix | 7-10 | 4 | |
| α-helix | 14-16 | 3 | |
| β-strand | 18 | 1 | 2 |
| β-strand | 23 | 1 | 3 |
| α-helix | 25-42 | 18 | |
| β-strand | 48 | 1 | 4 |
| α-helix | 50-56 | 7 | |
| β-strand | 64 | 1 | 3 |
| α-helix | 68-77 | 10 | |
| β-strand | 80 | 1 | 5 |
| β-strand | 82 | 1 | 4 |
| α-helix | 98-100 | 3 | |
| β-strand | 105 | 1 | 5 |
| β-strand | 109-112 | 4 | 1 |
| α-helix | 113-114 | 2 | |
| α-helix | 118-127 | 10 | |
| β-strand | 130-134 | 5 | 1 |
| α-helix | 139-142 | 4 | |
| β-strand | 148-149 | 2 | 1 |
| β-strand | 159-167 | 9 | 1 |
| β-strand | 170-174 | 5 | 1 |
| β-strand | 177 | 1 | 2 |
| β-strand | 183 | 1 | 1 |
| β-strand | 186-190 | 5 | 1 |
| α-helix | 199-201 | 3 | |
| β-strand | 207-210 | 4 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Papain | AAA | protein | 212 | Carica papaya | P00784 (AlphaFold model) |
>6TCX_1 Papain (chains AAA) IPEYVDWRQKGAVTPVKNQGSCGSCWAFSAVVTIEGIIKIRTGNLNEYSEQELLDCDRRS YGCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGA LLYSIANQPVSVVLEAAGKDFQLYRGGIFVGPCGNKVDHAVAAVGYGPNYILIKNSWGTG WGENGYIRIKRGTGNSYGVCGLYTSSFYPVKN
| ID | Name | Formula | Copies |
|---|---|---|---|
| N1W | (2~{R})-2-[[(1~{S})-1-[(6~{S})-2-azanyl-1,4,5,6-tetrahydropyrimidin-6-yl]-2-[[(… | C30 H41 N7 O7 | 1 |
Water and common crystallization additives (EPE) are not listed.
Decoding the Papain Inhibitor from Streptomyces mobaraensis as Being Hydroxylated Chymostatin Derivatives: Purification, Structure Analysis, and Putative Biosynthetic Pathway. Juettner, N.E., Bogen, J.P., Bauer, T.A. et al. J Nat Prod (2020) 83:2983-2995. DOI 10.1021/acs.jnatprod.0c00201 · PubMed
Other PDB entries of the same protein (UniProt P00784 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6TCX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.