Rapid optimisation of fragments and hits to lead compounds from screening of crude reaction mixtures. Determined by X-ray diffraction at 1.27 Å resolution. Released 14 Oct 2020.
Explore 6TN4 in 3D Show helices and sheets RCSB PDB PDBe
6TN4 contains 11 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 18-21 | 4 | 1 |
| α-helix | 22-23 | 2 | |
| α-helix | 24-35 | 12 | |
| α-helix | 43-65 | 23 | |
| α-helix | 67-70 | 4 | |
| β-strand | 78-83 | 6 | 1 |
| β-strand | 88-93 | 6 | 1 |
| α-helix | 100-104 | 5 | |
| α-helix | 106-108 | 3 | |
| α-helix | 111-123 | 13 | |
| α-helix | 128-134 | 7 | |
| α-helix | 137-143 | 7 | |
| β-strand | 145-153 | 9 | 1 |
| β-strand | 160-164 | 5 | 1 |
| β-strand | 169-174 | 6 | 1 |
| β-strand | 183-190 | 8 | 1 |
| α-helix | 195-198 | 4 | |
| α-helix | 200-210 | 11 | |
| β-strand | 218-220 | 3 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Heat shock protein HSP 90-alpha | AAA | protein | 230 | Homo sapiens | P07900 (AlphaFold model) |
>6TN4_1 Heat shock protein HSP 90-alpha (chains AAA) HMDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTD PSKLDSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGA DISMIGQFGVGFYSAYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDTGEPMGRGTKV ILHLKEDQTEYLEERRIKEIVKKHSQFIGYPITLFVEKERDKEVSDDEAE
| ID | Name | Formula | Copies |
|---|---|---|---|
| NLZ | 2,4-bis(oxidanyl)benzamide | C7 H7 N O3 | 1 |
Water and common crystallization additives (CL) are not listed.
Rapid optimisation of fragments and hits to lead compounds from screening of crude reaction mixtures. Baker, L.M., Aimon, A., Murray, J.B. et al. Commun Chem (2020). DOI 10.1038/s42004-020-00367-0
Other PDB entries of the same protein (UniProt P07900 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6TN4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.