6TU3: Rat 20S proteasome
Rat 20S proteasome. Determined by electron microscopy at 2.7 Å resolution. Released 13 May 2020.
- Method
- Electron microscopy
- Resolution
- 2.7 Å
- Organism
- Rattus norvegicus
- Chains
- 28
- Atoms
- 47,002
- Mol. weight
- 762.57 kDa
- Released
- 13 May 2020
Explore 6TU3 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
6TU3 contains 190 α-helices and 410 β-strands across 28 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chains a and M: 4 helices, 17 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 11-16 | 6 | 87 |
| β-strand | 21-26 | 6 | 87 |
| β-strand | 29-31 | 3 | 88 |
| β-strand | 34-37 | 4 | 88 |
| β-strand | 43-47 | 5 | 89 |
| β-strand | 50-53 | 4 | 89 |
| β-strand | 56 | 1 | 90 |
| α-helix | 58-79 | 22 | |
| α-helix | 85-98 | 14 | |
| β-strand | 106 | 1 | 90 |
| β-strand | 109-112 | 4 | 89 |
| β-strand | 113 | 1 | 91 |
| β-strand | 119 | 1 | 91 |
| β-strand | 121-124 | 4 | 89 |
| β-strand | 130-133 | 4 | 89 |
| β-strand | 135-139 | 5 | 87 |
| α-helix | 142-152 | 11 | |
| α-helix | 168-183 | 16 | |
| β-strand | 186 | 1 | 40 |
| β-strand | 192-198 | 7 | 87 |
| β-strand | 204-209 | 6 | 87 |
Chain A: 9 helices, 12 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 23-32 | 10 | |
| β-strand | 38-43 | 6 | 1 |
| β-strand | 47-53 | 7 | 1 |
| β-strand | 61 | 1 | 2 |
| α-helix | 63-65 | 3 | |
| β-strand | 69-73 | 5 | 3 |
| β-strand | 76-82 | 7 | 3 |
| α-helix | 84-105 | 22 | |
| α-helix | 108-110 | 3 | |
| α-helix | 111-125 | 15 | |
| β-strand | 136-144 | 9 | 3 |
| β-strand | 148-154 | 7 | 3 |
| β-strand | 162 | 1 | 3 |
| β-strand | 163 | 1 | 4 |
| β-strand | 165-169 | 5 | 1 |
| α-helix | 172-180 | 9 | |
| α-helix | 186-188 | 3 | |
| α-helix | 194-204 | 11 | |
| β-strand | 215-221 | 7 | 1 |
| β-strand | 228-229 | 2 | 1 |
| α-helix | 232-241 | 10 | |
Chains b and N: 5 helices, 17 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 7-8 | 2 | 92 |
| β-strand | 11-16 | 6 | 93 |
| β-strand | 19-25 | 7 | 93 |
| β-strand | 28-29 | 2 | 92 |
| β-strand | 33 | 1 | 38 |
| β-strand | 34-36 | 3 | 92 |
| β-strand | 42-46 | 5 | 94 |
| β-strand | 49-52 | 4 | 94 |
| β-strand | 55-56 | 2 | 92 |
| α-helix | 57-76 | 20 | |
| α-helix | 85-101 | 17 | |
| β-strand | 108 | 1 | 92 |
| β-strand | 110-116 | 7 | 94 |
| β-strand | 119-125 | 7 | 94 |
| β-strand | 131-133 | 3 | 94 |
| β-strand | 136-138 | 3 | 93 |
| α-helix | 142-145 | 4 | |
| α-helix | 147-156 | 10 | |
| α-helix | 162-179 | 18 | |
| β-strand | 180 | 1 | 35 |
| β-strand | 187-193 | 7 | 93 |
| β-strand | 196-203 | 8 | 93 |
Chains B and P: 9 helices, 14 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 8 | 1 | 7 |
| α-helix | 19-28 | 10 | |
| β-strand | 34-39 | 6 | 8 |
| β-strand | 42-48 | 7 | 8 |
| β-strand | 56 | 1 | 4 |
| α-helix | 58-60 | 3 | |
| β-strand | 65-66 | 2 | 9 |
| β-strand | 72-76 | 5 | 9 |
| α-helix | 79-100 | 22 | |
| α-helix | 103-105 | 3 | |
| α-helix | 106-119 | 14 | |
| β-strand | 124 | 1 | 7 |
| β-strand | 132-138 | 7 | 9 |
| β-strand | 143-148 | 6 | 9 |
| β-strand | 154-156 | 3 | 9 |
| β-strand | 157 | 1 | 10 |
| β-strand | 159-162 | 4 | 8 |
| α-helix | 166-176 | 11 | |
| α-helix | 183-196 | 14 | |
| β-strand | 207-213 | 7 | 8 |
| β-strand | 216-219 | 4 | 8 |
| α-helix | 220-221 | 2 | |
| α-helix | 222-230 | 9 | |
Chains C and Q: 8 helices, 12 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 19-29 | 11 | |
| β-strand | 34-39 | 6 | 15 |
| β-strand | 42-48 | 7 | 15 |
| β-strand | 56 | 1 | 10 |
| β-strand | 67 | 1 | 16 |
| β-strand | 73-78 | 6 | 16 |
| α-helix | 80-101 | 22 | |
| α-helix | 104-106 | 3 | |
| α-helix | 107-120 | 14 | |
| β-strand | 124 | 1 | 17 |
| α-helix | 128-130 | 3 | |
| β-strand | 132-138 | 7 | 16 |
| β-strand | 146-150 | 5 | 16 |
| β-strand | 159 | 1 | 18 |
| β-strand | 161-164 | 4 | 15 |
| α-helix | 168-176 | 9 | |
| α-helix | 186-200 | 15 | |
| β-strand | 211-219 | 9 | 15 |
| β-strand | 222-227 | 6 | 15 |
| α-helix | 230-247 | 18 | |
Chains D and R: 8 helices, 13 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 17-26 | 10 | |
| β-strand | 32-36 | 5 | 19 |
| β-strand | 40-46 | 7 | 19 |
| β-strand | 54 | 1 | 18 |
| α-helix | 56-58 | 3 | |
| β-strand | 62-64 | 3 | 20 |
| β-strand | 69-74 | 6 | 20 |
| α-helix | 77-98 | 22 | |
| α-helix | 101-103 | 3 | |
| α-helix | 104-117 | 14 | |
| β-strand | 124 | 1 | 17 |
| β-strand | 130-135 | 6 | 20 |
| β-strand | 143-147 | 5 | 20 |
| β-strand | 153-155 | 3 | 20 |
| β-strand | 156 | 1 | 21 |
| β-strand | 158-161 | 4 | 19 |
| α-helix | 165-175 | 11 | |
| α-helix | 184-196 | 13 | |
| β-strand | 206-212 | 7 | 19 |
| β-strand | 218-219 | 2 | 19 |
| α-helix | 222-232 | 11 | |
Chains E and S: 8 helices, 15 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 22-29 | 8 | |
| β-strand | 37-41 | 5 | 22 |
| β-strand | 46-51 | 6 | 22 |
| β-strand | 59 | 1 | 21 |
| α-helix | 61-63 | 3 | |
| β-strand | 67-71 | 5 | 23 |
| β-strand | 74-77 | 4 | 23 |
| β-strand | 79-80 | 2 | 24 |
| α-helix | 85-103 | 19 | |
| α-helix | 109-117 | 9 | |
| β-strand | 123 | 1 | 25 |
| β-strand | 133 | 1 | 25 |
| β-strand | 139-140 | 2 | 24 |
| β-strand | 141-145 | 5 | 23 |
| β-strand | 152-156 | 5 | 23 |
| β-strand | 162-165 | 4 | 23 |
| β-strand | 167-170 | 4 | 22 |
| α-helix | 174-184 | 11 | |
| α-helix | 191-205 | 15 | |
| β-strand | 215-220 | 6 | 22 |
| β-strand | 227-228 | 2 | 22 |
| α-helix | 229-230 | 2 | |
| α-helix | 233-240 | 8 | |
Chains F and T: 9 helices, 16 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 20-29 | 10 | |
| α-helix | 33-34 | 2 | |
| β-strand | 35-39 | 5 | 26 |
| β-strand | 43-49 | 7 | 26 |
| β-strand | 58 | 1 | 23 |
| β-strand | 63-65 | 3 | 27 |
| β-strand | 70-73 | 4 | 27 |
| β-strand | 75-76 | 2 | 28 |
| α-helix | 78-99 | 22 | |
| α-helix | 105-117 | 13 | |
| α-helix | 118-121 | 4 | |
| β-strand | 130-131 | 2 | 28 |
| β-strand | 132-133 | 2 | 29 |
| β-strand | 134-136 | 3 | 27 |
| β-strand | 143 | 1 | 27 |
| β-strand | 146-147 | 2 | 29 |
| β-strand | 154 | 1 | 29 |
| β-strand | 156 | 1 | 30 |
| β-strand | 158-159 | 2 | 26 |
| α-helix | 166-175 | 10 | |
| α-helix | 176-178 | 3 | |
| α-helix | 184-197 | 14 | |
| β-strand | 210-216 | 7 | 26 |
| β-strand | 219-224 | 6 | 26 |
| α-helix | 230-232 | 3 | |
8 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Proteasome subunit alpha type-6 | A, O | protein | 246 | Rattus norvegicus | P60901 (AlphaFold model) |
| Proteasome subunit alpha type-2 | B, P | protein | 234 | Rattus norvegicus | P17220 (AlphaFold model) |
| Proteasome subunit alpha type-4 | C, Q | protein | 261 | Rattus norvegicus | P21670 (AlphaFold model) |
| Proteasome subunit alpha type-7 | D, R | protein | 254 | Rattus norvegicus | P48004 (AlphaFold model) |
| Proteasome subunit alpha type-5 | E, S | protein | 241 | Rattus norvegicus | P34064 |
| Proteasome subunit alpha type-1 | F, T | protein | 263 | Rattus norvegicus | P18420 |
| Proteasome subunit alpha type-3 | G, U | protein | 255 | Rattus norvegicus | P18422 |
| Proteasome subunit beta type-6 | H, V | protein | 238 | Rattus norvegicus | P28073 |
| Proteasome subunit beta type-7 | I, W | protein | 277 | Rattus norvegicus | Q9JHW0 |
| Proteasome subunit beta type-3 | J, X | protein | 205 | Rattus norvegicus | P40112 |
| Proteasome subunit beta type-2 | K, Y | protein | 201 | Rattus norvegicus | P40307 |
| Proteasome subunit beta type-5 | L, Z | protein | 263 | Rattus norvegicus | P28075 |
2 more molecules are not listed.
Sequence of entity 1 (A, O), FASTA
>6TU3_1 Proteasome subunit alpha type-6 (chains A, O)
MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL
LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD
ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE
KKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLV
ALAERD
Sequence of entity 2 (B, P), FASTA
>6TU3_2 Proteasome subunit alpha type-2 (chains B, P)
MAERGYSFSLTTFSPSGKLVQIEYALAAVAGGAPSVGIKAANGVVLATEKKQKSILYDER
SVHKVEPITKHIGLVYSGMGPDYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQE
YTQSGGVRPFGVSLLICGWNEGRPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYNE
DLELEDAIHTAILTLKESFEGQMTEDNIEVGICNEAGFRRLTPTEVRDYLAAIA
Sequence of entity 3 (C, Q), FASTA
>6TU3_3 Proteasome subunit alpha type-4 (chains C, Q)
MSRRYDSRTTIFSPEGRLYQVEYAMEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVF
FSEKIYKLNEDMACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQA
YTQFGGKRPFGVSLLYIGWDKHYGFQLYQSDPSGNYGGWKATCIGNNSAAAVSMLKQDYK
EGEMTLKSALALAVKVLNKTMDVSKLSAEKVEIATLTRENGKTVIRVLKQKEVEQLIKKH
EEEEAKAEREKKEKEQREKDK
Sequence of entity 4 (D, R), FASTA
>6TU3_4 Proteasome subunit alpha type-7 (chains D, R)
MSYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGRDIVVLGVEKKSVAKLQDERTVR
KICALDDNVCMAFAVVASVSGLTADARIVINRARVECQSHRLTVGDPVTVEYITRYIASL
KQRYTQSNGRRPFGISALIVGFDFDGTPRLYQTDPSGTYHAWKANAIGRGAKSVREFLEK
NYTDDAIETDDLTIKLVIKALLEVVQSGGKNIELAVMRRDQPLKILSPEEIEKYVAEIEK
EKEENEKKKQKKAS
Sequence of entity 5 (E, S), FASTA
>6TU3_5 Proteasome subunit alpha type-5 (chains E, S)
MFLTRSEYDRGVNTFSPEGRLFQVEYAIEGHKLGSTAIGIQTSEGVCLAVEKRITSPLME
PSSIEKIVEIDAHIGCAMSGLIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLA
LQFGEEDADPGAMSRPFGVALLFGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSS
LQEVYHKSTTLKEAIKSSLIILKQVMEEKLNATNIELATVQPGQNFHMFTKEELEEVIKD
I
Sequence of entity 6 (F, T), FASTA
>6TU3_6 Proteasome subunit alpha type-1 (chains F, T)
MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQ
KKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPT
QRYGRRPYGVGLLIAGYDDMGPHVFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFM
QCNLDELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLDGLEERP
QRKAQPSQAADEPAEKADEPMEH
Sequence of entity 7 (G, U), FASTA
>6TU3_7 Proteasome subunit alpha type-3 (chains G, U)
MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYE
EGSNKRLFNVDRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYV
HAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKL
QMKEMTCRDVVKEVAKIIYIVHDEVKDKAFELELSWVGELTKGRHEIVPKDVREEAEKYA
KESLKEEDESDDDNM
Sequence of entity 8 (H, V), FASTA
>6TU3_8 Proteasome subunit beta type-6 (chains H, V)
MAAALAVRGAVSAPAFGPEALTPDWENREVSTGTTIMAVQFDGGVVLGADSRTTTGSYIA
NRVTDKLTPIHDHIFCCRSGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLFKEMC
YRYREDLMAGIIIAGWDPQEGGQVYSVPMGGMMVRQSFAIGGSGSSYIYGYVDATYREGM
TKDECLQFTANALALAMERDGSSGGVIRLAAIQQSGVERQVLLGDQIPKVTISTLPPP
Sequence of entity 9 (I, W), FASTA
>6TU3_9 Proteasome subunit beta type-7 (chains I, W)
MAAVSVFQAPVGGFSFDNCRRNAVLEADFAKKGFKLPKARKTGTTIAGVVYKDGIVLGAD
TRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLTTGRLPRVV
TANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAV
FEDKFRPDMEEEEAKKLVSEAIAAGIFNDLGSGSNIDLCVISKSKLDFLRPYSVPNKKGT
RFGRYRCEKGTTAVLTEKVTPLELEVLEEIVQTMDTS
Sequence of entity 10 (J, X), FASTA
>6TU3_10 Proteasome subunit beta type-3 (chains J, X)
MSVMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDV
QTVAQRLKFRLNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPF
ICSLDLIGCPMVTDDFVVSGTCSEQMYGMCESLWEPNMDPEHLFETISQAMLNAVDRDAV
SGMGVIVHIIEKDKITTRTLKARMD
Sequence of entity 11 (K, Y), FASTA
>6TU3_11 Proteasome subunit beta type-2 (chains K, Y)
MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYI
QKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDY
LAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSV
RVIDKDGIHNLENITFTKRSS
Sequence of entity 12 (L, Z), FASTA
>6TU3_12 Proteasome subunit beta type-5 (chains L, Z)
MALASVLQRPMPVNQHGFFGLGGRADLLDLGPGSPGDGLSLAAPSWGVPEEPRIEMLHGT
TTLAFKFQHGVIVAADSRATAGPYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLAR
QCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRI
SGTAFSVGSGSVYAFGVMDRGYSYDLQVEEAYDLARRAIYQATYRDAYSGGAVNLYHVRE
DGWIRVSSDNVADLHDKYTSSIP
Primary citation
Comparative Structural Analysis of 20S Proteasome Ortholog Protein Complexes by Native Mass Spectrometry. Vimer, S., Ben-Nissan, G., Morgenstern, D. et al. ACS Cent Sci (2020) 6:573-588. DOI 10.1021/acscentsci.0c00080 · PubMed
Other PDB entries of the same protein (UniProt P60901 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 6EPF 11.8 Å, Ground state 26S proteasome (GS1)
- 6EPC 12.3 Å, Ground state 26S proteasome (GS2)
- 6EPE 12.8 Å, Substrate processing state 26S proteasome (SPS2)
- 6EPD 15.4 Å, Substrate processing state 26S proteasome (SPS1)
Browse structure collections
About this viewer
MolViewer shows 6TU3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.