6U07: Stabilized T cell receptor constant domain

Computational Stabilization of T Cell Receptor Constant Domains. Determined by X-ray diffraction at 1.76 Å resolution. Released 15 Apr 2020.

Method: X-ray diffraction
Resolution: 1.76 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,904
Mol. weight: 27.1 kDa
Ligands: MG
Released: 15 Apr 2020

Explore 6U07 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6U07 contains 9 α-helices and 19 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	126-132	7	1
β-strand	139-144	6	1
α-helix	150-155	6
β-strand	160-162	3	1
α-helix	163-165	3
β-strand	166-170	5	1
α-helix	171-173	3
β-strand	175-184	10	1
α-helix	191-194	4
β-strand	205	1	1

Chain B: 5 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	123	1	2
α-helix	124-125	2
β-strand	126-131	6	1
α-helix	132-133	2
α-helix	134-140	7
β-strand	142-152	11	1
β-strand	153	1	2
β-strand	157-163	7	3
β-strand	166-168	3	3
β-strand	172-174	3	1
β-strand	179-180	2	1
β-strand	190-199	10	1
α-helix	200-204	5
β-strand	209-216	8	3
β-strand	219	1	4
α-helix	230-231	2
β-strand	233	1	4
β-strand	235-242	8	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Stabilized T cell receptor constant domain (Calpha)	A	protein	106	Homo sapiens	Q2YD82 (AlphaFold model)
Stabilized T cell receptor constant domain (Cbeta)	B	protein	131	Homo sapiens	K7N5M4 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6U07_1 Stabilized T cell receptor constant domain (Calpha) (chains A)
HHHHHHHHGSPYIQNPDPAVYQLRDSKSSDKFVCLFTDFDSQINVSQSKDSDVYITDKCV
LDMRSMDFKSNSAVAWSNKSDFTCANAFNNSIIPEDTFFPSPESSC

Sequence of entity 2 (B), FASTA

>6U07_2 Stabilized T cell receptor constant domain (Cbeta) (chains B)
EDLKNVFPPEVAVFEPSKAEISRTQKATLVCLATGFYPPHVELSWWVNGKEVHDGVCTDP
QPLKEQPALNDSRYALSSRLRVSATFWQDPRNHFRCQVQFYGLSENDEWTQDRAKPVTQI
VSAEAWGRADC

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	3

Primary citation

Computational stabilization of T cell receptors allows pairing with antibodies to form bispecifics. Froning, K., Maguire, J., Sereno, A. et al. Nat Commun (2020) 11:2330-2330. DOI 10.1038/s41467-020-16231-7 · PubMed

Other PDB entries of the same protein (UniProt Q2YD82 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4OZF 2.7 Å, JR5.1 protein complex
4OZH 2.8 Å, S16 protein complex
4OZG 3.0 Å, D2 protein complex
4OZI 3.2 Å, S2 protein complex

Browse structure collections

About this viewer

MolViewer shows 6U07 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.