Discovery of Lysine-Targeted eIF4E Inhibitors through Covalent Docking. Determined by X-ray diffraction at 1.79 Å resolution. Released 23 Oct 2019.
Explore 6U09 in 3D Show helices and sheets RCSB PDB PDBe
6U09 contains 40 α-helices and 36 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 31-33 | 3 | |
| β-strand | 38-48 | 11 | 1 |
| α-helix | 57-59 | 3 | |
| β-strand | 60-68 | 9 | 1 |
| α-helix | 69-76 | 8 | |
| β-strand | 79 | 1 | 2 |
| α-helix | 82-84 | 3 | |
| α-helix | 86 | 1 | |
| β-strand | 90-95 | 6 | 1 |
| β-strand | 111-116 | 6 | 1 |
| α-helix | 121-124 | 4 | |
| α-helix | 126-138 | 13 | |
| α-helix | 143-148 | 6 | |
| β-strand | 149-155 | 7 | 1 |
| β-strand | 162-167 | 6 | 1 |
| α-helix | 173-186 | 14 | |
| β-strand | 196-199 | 4 | 1 |
| α-helix | 200-203 | 4 | |
| β-strand | 215-216 | 2 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 38-48 | 11 | 3 |
| α-helix | 56-59 | 4 | |
| β-strand | 60-68 | 9 | 3 |
| α-helix | 69-78 | 10 | |
| β-strand | 79 | 1 | 4 |
| α-helix | 82-84 | 3 | |
| α-helix | 86 | 1 | |
| β-strand | 90-95 | 6 | 3 |
| β-strand | 111-116 | 6 | 3 |
| α-helix | 121 | 1 | |
| α-helix | 122-126 | 5 | |
| α-helix | 127-138 | 12 | |
| α-helix | 143-148 | 6 | |
| β-strand | 149-155 | 7 | 3 |
| β-strand | 162-167 | 6 | 3 |
| α-helix | 173-186 | 14 | |
| β-strand | 196-199 | 4 | 3 |
| α-helix | 200-203 | 4 | |
| β-strand | 215-216 | 2 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 31-34 | 4 | |
| β-strand | 35 | 1 | 4 |
| β-strand | 38-48 | 11 | 5 |
| α-helix | 57-59 | 3 | |
| β-strand | 60-68 | 9 | 5 |
| α-helix | 69-78 | 10 | |
| α-helix | 82-84 | 3 | |
| α-helix | 86 | 1 | |
| β-strand | 90-95 | 6 | 5 |
| β-strand | 111-116 | 6 | 5 |
| α-helix | 121-124 | 4 | |
| α-helix | 126-138 | 13 | |
| α-helix | 143-148 | 6 | |
| β-strand | 149-155 | 7 | 5 |
| β-strand | 162-167 | 6 | 5 |
| α-helix | 173-187 | 15 | |
| β-strand | 196-199 | 4 | 5 |
| α-helix | 200-203 | 4 | |
| β-strand | 215-216 | 2 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 31-34 | 4 | |
| β-strand | 35 | 1 | 2 |
| β-strand | 38-49 | 12 | 6 |
| α-helix | 56-58 | 3 | |
| β-strand | 61-68 | 8 | 6 |
| α-helix | 69-76 | 8 | |
| α-helix | 82-84 | 3 | |
| α-helix | 86 | 1 | |
| β-strand | 89-95 | 7 | 6 |
| β-strand | 111-117 | 7 | 6 |
| α-helix | 121-124 | 4 | |
| α-helix | 126-138 | 13 | |
| α-helix | 143-148 | 6 | |
| β-strand | 149-155 | 7 | 6 |
| β-strand | 161-167 | 7 | 6 |
| α-helix | 173-187 | 15 | |
| β-strand | 196-199 | 4 | 6 |
| α-helix | 200-204 | 5 | |
| β-strand | 215-216 | 2 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Eukaryotic translation initiation factor 4E | A, B, C, D | protein | 190 | Mus musculus | P63073 (AlphaFold model) |
>6U09_1 Eukaryotic translation initiation factor 4E (chains A, B, C, D) VANPEHYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMP GCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLDRFWLETLLCLIGESFDDYSD DVCGAVVNVRAKGDKIAIWTTECENRDAVTHIGRVYKERLGLPPKIVIGYQSHADTATKS GSTTKNRFVV
| ID | Name | Formula | Copies |
|---|---|---|---|
| EI9 | 3-{(1-oxo-1,2-dihydroisoquinolin-7-yl)[(pyridin-4-yl)methyl]sulfamoyl}benzene-1… | C21 H16 F N3 O5 S2 | 4 |
Discovery of Lysine-Targeted eIF4E Inhibitors through Covalent Docking. Wan, X., Yang, T., Cuesta, A. et al. J Am Chem Soc (2020) 142:4960-4964. DOI 10.1021/jacs.9b10377 · PubMed
Other PDB entries of the same protein (UniProt P63073 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6U09 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.