Structure-based discovery of a novel small-molecule inhibitor of methicillin-resistant S. aureus. Determined by X-ray diffraction at 2.79 Å resolution. Released 25 Mar 2020.
Explore 6U3T in 3D Show helices and sheets RCSB PDB PDBe
6U3T contains 7 α-helices and 45 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 19-29 | 11 | 1 |
| β-strand | 34-44 | 11 | 1 |
| β-strand | 48 | 1 | 2 |
| β-strand | 50-57 | 8 | 1 |
| β-strand | 60-61 | 2 | 1 |
| β-strand | 66-71 | 6 | 3 |
| β-strand | 75-89 | 15 | 3 |
| β-strand | 97-102 | 6 | 1 |
| β-strand | 107 | 1 | 3 |
| β-strand | 111-116 | 6 | 4 |
| β-strand | 144-149 | 6 | 4 |
| β-strand | 153-158 | 6 | 3 |
| β-strand | 164-171 | 8 | 3 |
| β-strand | 174 | 1 | 5 |
| β-strand | 182 | 1 | 5 |
| β-strand | 192 | 1 | 3 |
| β-strand | 197 | 1 | 6 |
| α-helix | 206-209 | 4 | |
| β-strand | 210 | 1 | 6 |
| α-helix | 211-212 | 2 | |
| α-helix | 213-215 | 3 | |
| β-strand | 224 | 1 | 1 |
| β-strand | 228-235 | 8 | 1 |
| β-strand | 242-260 | 19 | 3 |
| β-strand | 265-285 | 21 | 3 |
| β-strand | 290-292 | 3 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 18-29 | 12 | 2 |
| β-strand | 34-45 | 12 | 2 |
| β-strand | 50-57 | 8 | 2 |
| β-strand | 60-61 | 2 | 2 |
| β-strand | 66-71 | 6 | 7 |
| β-strand | 75-89 | 15 | 7 |
| β-strand | 97-102 | 6 | 2 |
| β-strand | 107 | 1 | 7 |
| β-strand | 111-116 | 6 | 8 |
| β-strand | 144-149 | 6 | 8 |
| β-strand | 153-158 | 6 | 7 |
| β-strand | 164-171 | 8 | 7 |
| β-strand | 174 | 1 | 9 |
| β-strand | 182 | 1 | 9 |
| β-strand | 192 | 1 | 7 |
| β-strand | 197 | 1 | 10 |
| α-helix | 206-209 | 4 | |
| β-strand | 210 | 1 | 10 |
| α-helix | 211-212 | 2 | |
| α-helix | 213-215 | 3 | |
| α-helix | 218-221 | 4 | |
| β-strand | 224 | 1 | 2 |
| β-strand | 228-235 | 8 | 2 |
| β-strand | 242-260 | 19 | 7 |
| β-strand | 265-285 | 21 | 7 |
| β-strand | 290-292 | 3 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Alpha-hemolysin | A, B | protein | 293 | Staphylococcus aureus | P09616 (AlphaFold model) |
>6U3T_1 Alpha-hemolysin (chains A, B) ADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMAKKVFYSFIDDKNHNKKLLVIRTKGT IAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLTYGF NGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVIFNNMVNQNWG PYDRDSWNPVYGNQLFMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASK QQTNIDVIYERVRDDYQLHWTSTNWKGTNTKDKWTDRSSERYKIDWEKEEMTN
| ID | Name | Formula | Copies |
|---|---|---|---|
| PQJ | fos-choline-14 | C19 H43 N O4 P | 4 |
Water and common crystallization additives (SO4) are not listed.
Structure-based discovery of a small-molecule inhibitor of methicillin-resistantStaphylococcus aureusvirulence. Liu, J., Kozhaya, L., Torres, V.J. et al. J Biol Chem (2020) 295:5944-5959. DOI 10.1074/jbc.RA120.012697 · PubMed
Other PDB entries of the same protein (UniProt P09616 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6U3T directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.