Crystal structure of DNMT3B-DNMT3L in complex with CpApG DNA. Determined by X-ray diffraction at 2.95 Å resolution. Released 10 Jun 2020.
Explore 6U8X in 3D Show helices and sheets RCSB PDB PDBe
6U8X contains 61 α-helices and 44 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 564-566 | 3 | |
| β-strand | 575-580 | 6 | 1 |
| α-helix | 586-593 | 8 | |
| β-strand | 596 | 1 | 2 |
| α-helix | 597 | 1 | |
| β-strand | 598-604 | 7 | 1 |
| α-helix | 608-617 | 10 | |
| β-strand | 623-624 | 2 | 1 |
| α-helix | 628-630 | 3 | |
| α-helix | 633-639 | 7 | |
| β-strand | 644-648 | 5 | 1 |
| α-helix | 671-682 | 12 | |
| α-helix | 684-685 | 2 | |
| β-strand | 693-699 | 7 | 1 |
| α-helix | 704-713 | 10 | |
| β-strand | 721-722 | 2 | 1 |
| α-helix | 723-725 | 3 | |
| β-strand | 729 | 1 | 3 |
| β-strand | 732-737 | 6 | 1 |
| α-helix | 745-746 | 2 | |
| α-helix | 756-759 | 4 | |
| β-strand | 765-766 | 2 | 4 |
| β-strand | 771 | 1 | 3 |
| α-helix | 772-774 | 3 | |
| α-helix | 778-780 | 3 | |
| β-strand | 783 | 1 | 5 |
| β-strand | 788 | 1 | 5 |
| β-strand | 791-793 | 3 | 4 |
| β-strand | 796-798 | 3 | 4 |
| α-helix | 799-801 | 3 | |
| α-helix | 802-809 | 8 | |
| α-helix | 811-812 | 2 | |
| α-helix | 823-832 | 10 | |
| α-helix | 836-843 | 8 | |
| α-helix | 844-848 | 5 | |
| β-strand | 852 | 1 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 184-186 | 3 | |
| α-helix | 188-190 | 3 | |
| β-strand | 192-195 | 4 | 6 |
| α-helix | 200-206 | 7 | |
| β-strand | 219-221 | 3 | 6 |
| α-helix | 229-234 | 6 | |
| β-strand | 240-244 | 5 | 6 |
| α-helix | 258-270 | 13 | |
| β-strand | 281-286 | 6 | 6 |
| α-helix | 292-302 | 11 | |
| β-strand | 307-309 | 3 | 6 |
| β-strand | 321-325 | 5 | 6 |
| α-helix | 328-332 | 5 | |
| α-helix | 340-350 | 11 | |
| α-helix | 365-368 | 4 | |
| α-helix | 369-374 | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 184-186 | 3 | |
| α-helix | 188-190 | 3 | |
| β-strand | 192-195 | 4 | 7 |
| α-helix | 200-205 | 6 | |
| β-strand | 218-221 | 4 | 7 |
| α-helix | 229-234 | 6 | |
| β-strand | 240-244 | 5 | 7 |
| α-helix | 256-270 | 15 | |
| β-strand | 281-286 | 6 | 7 |
| α-helix | 292-301 | 10 | |
| α-helix | 305-306 | 2 | |
| β-strand | 307-309 | 3 | 7 |
| β-strand | 321-325 | 5 | 7 |
| α-helix | 328-330 | 3 | |
| α-helix | 340-347 | 8 | |
| α-helix | 362-366 | 5 | |
| α-helix | 369-374 | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 564-566 | 3 | |
| β-strand | 575-580 | 6 | 8 |
| α-helix | 586-593 | 8 | |
| β-strand | 596 | 1 | 9 |
| β-strand | 598-604 | 7 | 8 |
| α-helix | 608-618 | 11 | |
| β-strand | 623-624 | 2 | 8 |
| α-helix | 628-630 | 3 | |
| α-helix | 633-639 | 7 | |
| β-strand | 644-648 | 5 | 8 |
| α-helix | 671-682 | 12 | |
| α-helix | 684-685 | 2 | |
| β-strand | 693-699 | 7 | 8 |
| α-helix | 704-713 | 10 | |
| α-helix | 718 | 1 | |
| β-strand | 719-722 | 4 | 8 |
| α-helix | 723-725 | 3 | |
| β-strand | 729 | 1 | 10 |
| β-strand | 732-737 | 6 | 8 |
| α-helix | 745-746 | 2 | |
| α-helix | 756-759 | 4 | |
| β-strand | 765-766 | 2 | 11 |
| β-strand | 771 | 1 | 10 |
| α-helix | 772-774 | 3 | |
| α-helix | 778-780 | 3 | |
| β-strand | 783 | 1 | 12 |
| β-strand | 788 | 1 | 12 |
| β-strand | 791-793 | 3 | 11 |
| β-strand | 796-798 | 3 | 11 |
| α-helix | 799-801 | 3 | |
| α-helix | 802-809 | 8 | |
| α-helix | 811-812 | 2 | |
| α-helix | 823-831 | 9 | |
| α-helix | 836-843 | 8 | |
| α-helix | 844-848 | 5 | |
| β-strand | 852 | 1 | 9 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| DNA (cytosine-5)-methyltransferase 3B | A, D | protein | 291 | Homo sapiens | Q9UBC3 (AlphaFold model) |
| DNA (cytosine-5)-methyltransferase 3-like | B, C | protein | 209 | Homo sapiens | Q9UJW3 (AlphaFold model) |
| CpApG DNA (25-MER) | E, F | DNA | 25 | Homo sapiens |
>6U8X_1 DNA (cytosine-5)-methyltransferase 3B (chains A, D) LYPAIPAARRRPIRVLSLFDGIATGYLVLKELGIKVGKYVASEVCEESIAVGTVKHEGNI KYVNDVRNITKKNIEEWGPFDLVIGGSPCNDLSNVNPARKGLYEGTGRLFFEFYHLLNYS RPKEGDDRPFFWMFENVVAMKVGDKRDISRFLECNPVMIDAIKVSAAHRARYFWGNLPGM NRPVIASKNDKLELQDCLEYNRIAKLKKVQTITTKSNSIKQGKNQLFPVVMNGKEDVLWC TELERIFGFPVHYTDVSNMGRGARQKLLGRSWSVPVIRHLFAPLKDYFACE
>6U8X_2 DNA (cytosine-5)-methyltransferase 3-like (chains B, C) MFETVPVWRRQPVRVLSLFEDIKKELTSLGFLESGSDPGQLKHVVDVTDTVRKDVEEWGP FDLVYGATPPLGHTCDRPPSWYLFQFHRLLQYARPKPGSPRPFFWMFVDNLVLNKEDLDV ASRFLEMEPVTIPDVHGGSLQNAVRVWSNIPAIRSRHWALVSEEELSLLAQNKQSSKLAA KWPTKLVKNCFLPLREYFKYFSTELTSSL
>6U8X_3 CpApG DNA (25-MER) (chains E, F) CATGUAGTCTAATTAGACTGCATGG
Comprehensive structure-function characterization of DNMT3B and DNMT3A reveals distinctive de novo DNA methylation mechanisms. Gao, L., Emperle, M., Guo, Y. et al. Nat Commun (2020) 11:3355-3355. DOI 10.1038/s41467-020-17109-4 · PubMed
Other PDB entries of the same protein (UniProt Q9UBC3 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6U8X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.