Crystal structure of the Fc fragment of PF06438179/GP1111 an infliximab biosimilar in a C-centered orthorhombic crystal form, Lot A. Determined by X-ray diffraction at 2.0 Å resolution. Released 13 Nov 2019.
Explore 6UGW in 3D Show helices and sheets RCSB PDB PDBe
6UGW contains 11 α-helices and 20 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 242-246 | 5 | 1 |
| α-helix | 247-249 | 3 | |
| α-helix | 250-254 | 5 | |
| β-strand | 261-269 | 9 | 1 |
| β-strand | 277-282 | 6 | 2 |
| β-strand | 285-287 | 3 | 2 |
| β-strand | 291-292 | 2 | 1 |
| α-helix | 293-295 | 3 | |
| β-strand | 296-297 | 2 | 1 |
| β-strand | 303-310 | 8 | 1 |
| α-helix | 313-317 | 5 | |
| β-strand | 322-327 | 6 | 2 |
| β-strand | 335-339 | 5 | 2 |
| α-helix | 342-343 | 2 | |
| β-strand | 347 | 1 | 3 |
| α-helix | 348-349 | 2 | |
| β-strand | 350-354 | 5 | 4 |
| α-helix | 355-357 | 3 | |
| α-helix | 358-362 | 5 | |
| β-strand | 365-375 | 11 | 4 |
| β-strand | 376 | 1 | 3 |
| β-strand | 381-386 | 6 | 5 |
| β-strand | 389-391 | 3 | 5 |
| β-strand | 394-396 | 3 | 4 |
| α-helix | 397-399 | 3 | |
| β-strand | 400-401 | 2 | 4 |
| β-strand | 407-416 | 10 | 4 |
| α-helix | 417-421 | 5 | |
| β-strand | 426-431 | 6 | 5 |
| α-helix | 436-438 | 3 | |
| β-strand | 439-444 | 6 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| PF-06438179/GP1111 Fc | A | protein | 255 | Homo sapiens | P0DOX5 (AlphaFold model) |
>6UGW_1 PF-06438179/GP1111 Fc (chains A) MKKTAIAIAVALAGFATVAQADVESKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLM ISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQD WLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGF YPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEAL HNHYTQKSLSLSPGK
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 3 |
Water and common crystallization additives (ACT) are not listed.
Crystal Structures of PF-06438179/GP1111, an Infliximab Biosimilar. Lerch, T.F., Sharpe, P., Mayclin, S.J. et al. BioDrugs (2020) 34:77-87. DOI 10.1007/s40259-019-00390-1 · PubMed
Other PDB entries of the same protein (UniProt P0DOX5 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6UGW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.