6UGX: PF-06438179/GP1111 Fc

Crystal structure of the Fc fragment of PF06438179/GP1111 an infliximab biosimilar in a primative orthorhombic crystal form, Lot A. Determined by X-ray diffraction at 2.1 Å resolution. Released 13 Nov 2019.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,797
Mol. weight: 59.52 kDa
Released: 13 Nov 2019

Explore 6UGX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6UGX contains 20 α-helices and 40 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	242-246	5	1
α-helix	247-249	3
α-helix	250-254	5
β-strand	261-269	9	1
β-strand	277-282	6	2
β-strand	285-287	3	2
β-strand	291-292	2	1
α-helix	293-295	3
β-strand	296-297	2	1
β-strand	303-310	8	1
α-helix	313-317	5
β-strand	322-327	6	2
β-strand	335-339	5	2
β-strand	347	1	3
α-helix	348-349	2
β-strand	350-354	5	4
α-helix	358-362	5
β-strand	365-375	11	4
β-strand	376	1	3
β-strand	381-386	6	5
β-strand	389-390	2	5
β-strand	394-396	3	4
α-helix	397-399	3
β-strand	400-401	2	4
β-strand	407-416	10	4
α-helix	417-421	5
β-strand	426-431	6	5
α-helix	436-438	3
β-strand	440-444	5	5

Chain B: 11 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	242-246	5	6
α-helix	247-249	3
α-helix	250-254	5
β-strand	261-269	9	6
β-strand	276-282	7	7
β-strand	285-287	3	7
β-strand	291-292	2	6
α-helix	293-295	3
β-strand	296-297	2	6
β-strand	303-310	8	6
α-helix	313-317	5
β-strand	322-328	7	7
β-strand	335-339	5	7
α-helix	341-343	3
β-strand	347	1	8
α-helix	348-349	2
β-strand	350-354	5	9
α-helix	355-357	3
α-helix	358-362	5
β-strand	365-375	11	9
β-strand	376	1	8
β-strand	381-386	6	10
β-strand	389-390	2	10
β-strand	394-396	3	9
α-helix	397-399	3
β-strand	400-401	2	9
β-strand	407-416	10	9
α-helix	417-421	5
β-strand	426-431	6	10
α-helix	436-438	3
β-strand	439-444	6	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
PF-06438179/GP1111 Fc	A, B	protein	255	Homo sapiens	P0DOX5 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6UGX_1 PF-06438179/GP1111 Fc (chains A, B)
MKKTAIAIAVALAGFATVAQADVESKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLM
ISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQD
WLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGF
YPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEAL
HNHYTQKSLSLSPGK

Primary citation

Crystal Structures of PF-06438179/GP1111, an Infliximab Biosimilar. Lerch, T.F., Sharpe, P., Mayclin, S.J. et al. BioDrugs (2020) 34:77-87. DOI 10.1007/s40259-019-00390-1 · PubMed

Other PDB entries of the same protein (UniProt P0DOX5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6YT7 1.55 Å, Glycosylated knob/dummy-hole fc fragment
6YTB 1.65 Å, Glycosylated knob/dummy-hole/dummy fc fragment
6ARP 1.7 Å, Structure of a mutant Cetuximab Fab fragment
1N0X 1.8 Å, Crystal Structure of a Broadly Neutralizing Anti-HIV-1 Antibody in Complex with a…
6UOE 1.8 Å, 3-25 Fab germline-reversion variant bound to an HCMV gB-derived peptide
8ECV 1.81 Å, Bovine Fab 2F12
6G1E 1.88 Å, BEAT Fc with improved heterodimerization (Q3A-D84.4Q)
5W5L 1.9 Å, Crystal structure of human IgG1-Sigma Fc fragment
6UBI 1.9 Å, N123-VRC34.05 HIV neutralizing antibody in complex with HIV fusion peptide residue 512-519
6DKJ 1.95 Å, human GIPR ECD and Fab complex
6MSY 2.0 Å, Anti-HIV-1 Fab Fab 2G12 + Man4 re-refinement
6UGW 2.0 Å, Crystal structure of the Fc fragment of PF06438179/GP1111 an infliximab biosimilar in a…

Browse structure collections

About this viewer

MolViewer shows 6UGX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.