6UHY: WDR5

WDR5 in complex with Myc site fragment inhibitor. Determined by X-ray diffraction at 1.26 Å resolution. Released 15 Apr 2020.

Method: X-ray diffraction
Resolution: 1.26 Å
Organism: Homo sapiens
Chains: 2
Atoms: 5,479
Mol. weight: 67.47 kDa
Ligands: Q8G
Released: 15 Apr 2020

Explore 6UHY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6UHY contains 1 α-helix and 56 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 28 β-strands

Element	Residues	Length	Sheet
β-strand	36-42	7	1
β-strand	48-53	6	2
β-strand	59-64	6	2
β-strand	69-73	5	2
β-strand	79-83	5	2
β-strand	90-95	6	3
β-strand	101-106	6	3
β-strand	110-115	6	3
β-strand	121-126	6	3
β-strand	132-137	6	4
β-strand	143-148	6	4
β-strand	153-157	5	4
β-strand	163-167	5	4
β-strand	174-179	6	5
β-strand	185-190	6	5
β-strand	195-199	5	5
β-strand	205-209	5	5
α-helix	215-216	2
β-strand	217-222	6	6
β-strand	228-233	6	6
β-strand	237-242	6	6
β-strand	247-252	6	6
β-strand	264-267	4	7
β-strand	273-276	4	7
β-strand	283-287	5	7
β-strand	293-297	5	7
β-strand	304-309	6	1
β-strand	315-320	6	1
β-strand	326-331	6	1

Chain B: 0 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	36-41	6	8
β-strand	48-53	6	9
β-strand	59-64	6	9
β-strand	69-73	5	9
β-strand	79-83	5	9
β-strand	90-95	6	10
β-strand	101-106	6	10
β-strand	111-115	5	10
β-strand	121-125	5	10
β-strand	132-137	6	11
β-strand	143-148	6	11
β-strand	153-157	5	11
β-strand	163-167	5	11
β-strand	174-179	6	12
β-strand	185-190	6	12
β-strand	195-199	5	12
β-strand	205-208	4	12
β-strand	217-222	6	13
β-strand	228-233	6	13
β-strand	237-242	6	13
β-strand	247-252	6	13
β-strand	264-267	4	14
β-strand	273-276	4	14
β-strand	283-287	5	14
β-strand	293-297	5	14
β-strand	304-309	6	8
β-strand	315-320	6	8
β-strand	327-331	5	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
WDR5	A, B	protein	304	Homo sapiens	P61964 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6UHY_1 WDR5 (chains A, B)
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGI
SDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFD
ESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLI
DDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTG
GKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLW
KSDC

Ligands and cofactors

ID	Name	Formula	Copies
Q8G	1-cyclohexyl-1H-benzimidazole-5-carboxylic acid	C14 H16 N2 O2	2

Primary citation

Discovery of WD Repeat-Containing Protein 5 (WDR5)-MYC Inhibitors Using Fragment-Based Methods and Structure-Based Design. Chacon Simon, S., Wang, F., Thomas, L.R. et al. J Med Chem (2020) 63:4315-4333. DOI 10.1021/acs.jmedchem.0c00224 · PubMed

Other PDB entries of the same protein (UniProt P61964 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6E1Z 1.1 Å, Displacement of WDR5 from chromatin by a pharmacological WIN site inhibitor with…
6U6W 1.2 Å, Discovery and optimization of salicyclic acid-derived sulfonamide inhibitors of the…
6E1Y 1.22 Å, Discovery of Potent 2-Aryl-6,7-Dihydro-5HPyrrolo[ 1,2-a]imidazoles as WDR5 WIN-site…
6UHZ 1.26 Å, WDR5 in complex with Myc site fragment inhibitor
7BED 1.26 Å, X-ray structure of WDR5 bound to the WDR5 win motif peptide
6U8B 1.26 Å, Discovery and optimization of salicyclic acid-derived sulfonamide inhibitors of the…
24XP 1.3 Å, Crystal structure of WDR5 F133A variant in complex with MBD3C
4ERY 1.3 Å, X-ray structure of WDR5-MLL3 Win motif peptide binary complex
8G3E 1.33 Å, Crystal structure of human WDR5 in complex with (1M)-N-[(3,5-difluoro[1,1'-biphenyl]-4-yl…
3EMH 1.37 Å, Structural basis of WDR5-MLL interaction
3UVK 1.4 Å, Crystal structure of WDR5 in complex with the WDR5-interacting motif of MLL2
7WVK 1.42 Å, Crystal structure of human WDR5 in complex with compound 19

Browse structure collections

About this viewer

MolViewer shows 6UHY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.