WDR5 in complex with Myc site fragment inhibitor. Determined by X-ray diffraction at 1.26 Å resolution. Released 15 Apr 2020.
Explore 6UHZ in 3D Show helices and sheets RCSB PDB PDBe
6UHZ contains 1 α-helix and 56 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 36-41 | 6 | 1 |
| β-strand | 48-53 | 6 | 2 |
| β-strand | 59-64 | 6 | 2 |
| β-strand | 69-73 | 5 | 2 |
| β-strand | 79-83 | 5 | 2 |
| β-strand | 90-95 | 6 | 3 |
| β-strand | 101-106 | 6 | 3 |
| β-strand | 110-115 | 6 | 3 |
| β-strand | 121-126 | 6 | 3 |
| β-strand | 132-137 | 6 | 4 |
| β-strand | 143-148 | 6 | 4 |
| β-strand | 153-157 | 5 | 4 |
| β-strand | 163-167 | 5 | 4 |
| β-strand | 174-179 | 6 | 5 |
| β-strand | 185-190 | 6 | 5 |
| β-strand | 195-199 | 5 | 5 |
| β-strand | 205-209 | 5 | 5 |
| α-helix | 215-216 | 2 | |
| β-strand | 217-222 | 6 | 6 |
| β-strand | 228-233 | 6 | 6 |
| β-strand | 237-242 | 6 | 6 |
| β-strand | 247-252 | 6 | 6 |
| β-strand | 264-267 | 4 | 7 |
| β-strand | 273-276 | 4 | 7 |
| β-strand | 283-287 | 5 | 7 |
| β-strand | 293-297 | 5 | 7 |
| β-strand | 304-309 | 6 | 1 |
| β-strand | 315-320 | 6 | 1 |
| β-strand | 327-331 | 5 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 36-41 | 6 | 8 |
| β-strand | 48-53 | 6 | 9 |
| β-strand | 59-64 | 6 | 9 |
| β-strand | 69-73 | 5 | 9 |
| β-strand | 79-83 | 5 | 9 |
| β-strand | 90-95 | 6 | 10 |
| β-strand | 101-106 | 6 | 10 |
| β-strand | 110-115 | 6 | 10 |
| β-strand | 121-126 | 6 | 10 |
| β-strand | 132-137 | 6 | 11 |
| β-strand | 143-148 | 6 | 11 |
| β-strand | 153-157 | 5 | 11 |
| β-strand | 163-167 | 5 | 11 |
| β-strand | 174-179 | 6 | 12 |
| β-strand | 185-190 | 6 | 12 |
| β-strand | 195-199 | 5 | 12 |
| β-strand | 205-208 | 4 | 12 |
| β-strand | 217-222 | 6 | 13 |
| β-strand | 228-233 | 6 | 13 |
| β-strand | 237-242 | 6 | 13 |
| β-strand | 247-252 | 6 | 13 |
| β-strand | 264-267 | 4 | 14 |
| β-strand | 273-276 | 4 | 14 |
| β-strand | 283-287 | 5 | 14 |
| β-strand | 293-297 | 5 | 14 |
| β-strand | 304-309 | 6 | 8 |
| β-strand | 315-320 | 6 | 8 |
| β-strand | 327-331 | 5 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| WDR5 | A, B | protein | 304 | Homo sapiens | P61964 (AlphaFold model) |
>6UHZ_1 WDR5 (chains A, B) VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGI SDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFD ESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLI DDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTG GKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLW KSDC
| ID | Name | Formula | Copies |
|---|---|---|---|
| Q8D | 1-cyclohexyl-1H-benzotriazole-5-carboxylic acid | C13 H15 N3 O2 | 2 |
Discovery of WD Repeat-Containing Protein 5 (WDR5)-MYC Inhibitors Using Fragment-Based Methods and Structure-Based Design. Chacon Simon, S., Wang, F., Thomas, L.R. et al. J Med Chem (2020) 63:4315-4333. DOI 10.1021/acs.jmedchem.0c00224 · PubMed
Other PDB entries of the same protein (UniProt P61964 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6UHZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.