6UPS: ULP_PROTEASE domain-containing protein

Crystal structure of the deubiquitylase domain from the Orientia tsutsugamushi protein OTT_1962 (OtDUB). Determined by X-ray diffraction at 2.0 Å resolution. Released 1 Apr 2020.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Orientia tsutsugamushi (strain Ikeda)
Chains: 1
Atoms: 2,005
Mol. weight: 29.6 kDa
Released: 1 Apr 2020

Explore 6UPS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6UPS contains 12 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	12-14	3
α-helix	16-27	12
β-strand	33-35	3	1
β-strand	40	1	1
α-helix	44-60	17
β-strand	65-71	7	1
β-strand	77-84	8	1
β-strand	90-95	6	1
β-strand	98	1	2
α-helix	102-104	3
α-helix	106-115	10
β-strand	120-123	4	1
β-strand	127	1	2
α-helix	135-147	13
α-helix	150-154	5
α-helix	155-191	37
β-strand	196-197	2	3
α-helix	199-208	10
α-helix	214-224	11
β-strand	235-236	2	3
α-helix	237-245	9
α-helix	248-256	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ULP_PROTEASE domain-containing protein	A	protein	260	Orientia tsutsugamushi (strain Ikeda)	B3CVM3

Sequence of entity 1 (A), FASTA

>6UPS_1 ULP_PROTEASE domain-containing protein (chains A)
GMANDQDLSNPEYLYTEDDINQLLKHYLGLDDRISIIQHVALNESLLLKQTLHQVLSDIF
SGMQEKAVIPLHTGNNHWVAMAIKKGMNDDIVISYNDPMGVSIDDKVTLINCIKELCPGA
KINDLQTVQQTNVYDCGPFVVDNLIKMSQGQPILSTEEAKQQAQNIRQSQVNFLSENRMI
TSAAAALADTLLKNNNRITEGVLVDRIFDNKILSVQEKQQLLNNLLDNHIKENKSLTKES
LTRMLASTHFVQQQANVLLN

Primary citation

A deubiquitylase with an unusually high-affinity ubiquitin-binding domain from the scrub typhus pathogen Orientia tsutsugamushi. Berk, J.M., Lim, C., Ronau, J.A. et al. Nat Commun (2020) 11:2343-2343. DOI 10.1038/s41467-020-15985-4 · PubMed

Other PDB entries of the same protein (UniProt B3CVM3), best resolution first:

6X1G 1.6 Å, Crystal structure of a GEF domain from the Orientia tsutsugamushi protein OtDUB in…
6UPU 2.2 Å, Crystal structure of the Orientia tsutsugamushi OtDUB in complex with three molecules of…
6X1H 2.91 Å, Crystal structure of a guanine nucleotide exchange factor (GEF) domain from the Orientia…

Browse structure collections

About this viewer

MolViewer shows 6UPS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.