6UY1: Sth1 bromodomain from Saccharomyces cerevisiae
Crystal structure of the Sth1 bromodomain from Saccharomyces cerevisiae at 2.2 Angstrom resolution. Determined by X-ray diffraction at 2.21 Å resolution. Released 4 Dec 2019.
- Method
- X-ray diffraction
- Resolution
- 2.21 Å
- Organism
- Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
- Chains
- 8
- Atoms
- 8,223
- Mol. weight
- 109.99 kDa
- Ligands
- MG
- Released
- 4 Dec 2019
Explore 6UY1 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
6UY1 contains 64 α-helices and 16 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 8 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 21-33 | 13 | |
| β-strand | 36 | 1 | 1 |
| β-strand | 43 | 1 | 1 |
| α-helix | 46-48 | 3 | |
| α-helix | 51-53 | 3 | |
| α-helix | 58-63 | 6 | |
| α-helix | 70-78 | 9 | |
| α-helix | 85-102 | 18 | |
| α-helix | 104 | 1 | |
| α-helix | 108-126 | 19 | |
Chains B and D: 8 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 21-32 | 12 | |
| β-strand | 36 | 1 | 2 |
| β-strand | 43 | 1 | 2 |
| α-helix | 46-48 | 3 | |
| α-helix | 51-53 | 3 | |
| α-helix | 58-63 | 6 | |
| α-helix | 70-78 | 9 | |
| α-helix | 85-102 | 18 | |
| α-helix | 104 | 1 | |
| α-helix | 108-127 | 20 | |
Chain C: 8 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 22-33 | 12 | |
| β-strand | 36 | 1 | 3 |
| β-strand | 43 | 1 | 3 |
| α-helix | 46-48 | 3 | |
| α-helix | 51-53 | 3 | |
| α-helix | 58-63 | 6 | |
| α-helix | 70-78 | 9 | |
| α-helix | 85-102 | 18 | |
| α-helix | 104 | 1 | |
| α-helix | 108-126 | 19 | |
Chain E: 8 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 21-33 | 13 | |
| β-strand | 36 | 1 | 5 |
| β-strand | 43 | 1 | 5 |
| α-helix | 46-48 | 3 | |
| α-helix | 51-53 | 3 | |
| α-helix | 58-63 | 6 | |
| α-helix | 70-77 | 8 | |
| α-helix | 86-102 | 17 | |
| α-helix | 104 | 1 | |
| α-helix | 108-125 | 18 | |
Chain F: 8 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 21-32 | 12 | |
| β-strand | 36 | 1 | 6 |
| β-strand | 43 | 1 | 6 |
| α-helix | 46-48 | 3 | |
| α-helix | 51-53 | 3 | |
| α-helix | 58-63 | 6 | |
| α-helix | 70-78 | 9 | |
| α-helix | 86-102 | 17 | |
| α-helix | 104 | 1 | |
| α-helix | 108-126 | 19 | |
Chain G: 8 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 21-32 | 12 | |
| β-strand | 36 | 1 | 7 |
| β-strand | 43 | 1 | 7 |
| α-helix | 46-48 | 3 | |
| α-helix | 51-53 | 3 | |
| α-helix | 58-63 | 6 | |
| α-helix | 70-78 | 9 | |
| α-helix | 85-102 | 18 | |
| α-helix | 104 | 1 | |
| α-helix | 108-125 | 18 | |
Chain H: 8 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 22-32 | 11 | |
| β-strand | 36 | 1 | 8 |
| β-strand | 43 | 1 | 8 |
| α-helix | 46-48 | 3 | |
| α-helix | 51-53 | 3 | |
| α-helix | 58-63 | 6 | |
| α-helix | 70-79 | 10 | |
| α-helix | 85-102 | 18 | |
| α-helix | 104 | 1 | |
| α-helix | 108-128 | 21 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Nuclear protein STH1/NPS1 | A, B, C, D, E, F, G, H | protein | 114 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | P32597 (AlphaFold model) |
Sequence of entity 1 (A, B, C, D, E, F, G, H), FASTA
>6UY1_1 Nuclear protein STH1/NPS1 (chains A, B, C, D, E, F, G, H)
GPHMGIFPTVEKLVEEMREQLDEVDSHPRTSIFEKLPSKRDYPDYFKVIEKPMAIDIILK
NCKNGTYKTLEEVRQALQTMFENARFYNEEGSWVYVDADKLNEFTDEWFKEHSS
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| MG | Magnesium ion | Mg | 1 |
Primary citation
Crystal structure of the Sth1 bromodomain from Saccharomyces cerevisiae at 2.2 Angstrom resolution. Stavropoulos, P., Hoelz, A. To be published.
Other PDB entries of the same protein (UniProt P32597 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 6KMJ 1.4 Å, Crystal structure of Sth1 bromodomain in complex with H3K14Ac
- 7F3S 1.4 Å, Crystal structure of Sth1 Bromodomain in complex with H3K14bz peptide
- 6KMB 2.4 Å, Crystal structure of Sth1 bromodomain
- 6MR4 2.71 Å, Crystal structure of the Sth1 bromodomain from S.cerevisiae
- 6V8O 3.07 Å, RSC core
- 6K15 3.4 Å, RSC substrate-recruitment module
- 6VZ4 3.9 Å, Cryo-EM structure of Sth1-Arp7-Arp9-Rtt102 bound to the nucleosome in ADP Beryllium…
- 6VZG 4.2 Å, Cryo-EM structure of Sth1-Arp7-Arp9-Rtt102
- 6KW3 7.13 Å, The ClassA RSC-Nucleosome Complex
- 6KW4 7.55 Å, The ClassB RSC-Nucleosome Complex
- 6KW5 10.13 Å, The ClassC RSC-Nucleosome Complex
- 6TDA 15.0 Å, Structure of SWI/SNF chromatin remodeler RSC bound to a nucleosome
Browse structure collections
About this viewer
MolViewer shows 6UY1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.