6UZ6: GLUN1/GLUN2A-4M mutant ligand-binding domain

Crystal structure of GLUN1/GLUN2A-4M mutant ligand-binding domain in complex with glycine and glutamate. Determined by X-ray diffraction at 1.66 Å resolution. Released 29 Jan 2020.

Method: X-ray diffraction
Resolution: 1.66 Å
Organism: Rattus norvegicus
Chains: 2
Atoms: 5,175
Mol. weight: 65.17 kDa
Ligands: GLU, GLY
Released: 29 Jan 2020

Explore 6UZ6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6UZ6 contains 32 α-helices and 39 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	6-10	5	1
β-strand	13	1	2
β-strand	17	1	2
β-strand	18-21	4	1
α-helix	27-30	4
β-strand	32	1	3
α-helix	37	1
β-strand	38	1	3
α-helix	39-40	2
β-strand	42-47	6	1
β-strand	58-64	7	1
α-helix	66-78	13
β-strand	82-86	5	1
β-strand	95-97	3	4
β-strand	104-106	3	4
α-helix	108-115	8
β-strand	120-121	2	1
β-strand	126	1	5
α-helix	129-132	4
β-strand	136-137	2	1
α-helix	138	1
α-helix	140	1
β-strand	142-151	10	5
α-helix	162-165	4
β-strand	173-174	2	5
β-strand	176	1	6
α-helix	180-187	8
α-helix	189-191	3
α-helix	192-198	7
β-strand	203	1	6
α-helix	206-214	9
β-strand	220-224	5	5
α-helix	225-234	10
β-strand	238-250	13	5
β-strand	253-254	2	1
α-helix	261-274	14
α-helix	276-284	9

Chain B: 16 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	8-13	6	7
β-strand	16	1	8
β-strand	20	1	8
β-strand	21-24	4	7
α-helix	25-26	2
β-strand	37-44	8	7
β-strand	52-60	9	7
α-helix	62-74	13
β-strand	77-82	6	7
β-strand	91-92	2	9
β-strand	95-96	2	9
α-helix	98-104	7
β-strand	110-111	2	7
β-strand	116	1	10
α-helix	119-122	4
β-strand	126-127	2	7
α-helix	128-130	3
β-strand	132-141	10	10
α-helix	152-155	4
α-helix	157-159	3
α-helix	163-165	3
β-strand	166-167	2	10
α-helix	173-181	9
α-helix	183-189	7
α-helix	190-192	3
α-helix	197-205	9
β-strand	211-215	5	10
α-helix	216-225	10
β-strand	231-233	3	10
α-helix	234-236	3
β-strand	240-245	6	10
β-strand	248-249	2	7
α-helix	256-268	13
α-helix	271-279	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glutamate receptor ionotropic, NMDA 1	A	protein	292	Rattus norvegicus	P35439 (AlphaFold model)
Glutamate receptor ionotropic, NMDA 2A	B	protein	280	Rattus norvegicus	Q00959 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6UZ6_1 Glutamate receptor ionotropic, NMDA 1 (chains A)
GMSTRLKIVTIHQEPFVYVKPTMSDGTCKEEFTVNGDPVKKVICTGPNDTSPGSPRHTVP
QCCYGFCIDLLIKLARTMNFTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGQADM
IVAPLTINNERAQYIEFSKPFKYQGLTILVKKGTRITGINDPRLRNPSDKFIYATVKQSS
VDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVT
TGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTWVRYQECDS

Sequence of entity 2 (B), FASTA

>6UZ6_2 Glutamate receptor ionotropic, NMDA 2A (chains B)
DDNHLSIVTLEERPFVIVEDIDPLTETCVRNTVPCRKFVKINNSTNEGMNVKKCCKGFCI
DILKKLSRTVKFTYDLYLVTNGKHGKKVNNVWNGMIGEVVYQRAVMAVGSLTINEERSEV
VDFSVPFVETGISVMVSRGTQVTGLSDKKFQRPHDYSPPFRFGTVPNGSTERNIRNNYPY
MHQYMTRFNQRGVEDALVSLKTGKLDAFIYDAAVLNYMARKDEGCKLVTIGSGYIFATTG
YGIALQKGSPWKRQIDLALLQFVGDGEMEELETLWLTGIC

Ligands and cofactors

ID	Name	Formula	Copies
GLU	Glutamic acid	C5 H9 N O4	1
GLY	Glycine	C2 H5 N O2	1

Primary citation

Structural basis of subtype-selective competitive antagonism for GluN2C/2D-containing NMDA receptors. Wang, J.X., Irvine, M.W., Burnell, E.S. et al. Nat Commun (2020) 11:423-423. DOI 10.1038/s41467-020-14321-0 · PubMed

Other PDB entries of the same protein (UniProt P35439 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1PB7 1.35 Å, Crystal structure of the NR1 ligand binding core in complex with glycine at 1.35 Å…
1Y20 1.4 Å, Crystal structure of the NR1 ligand-binding core in complex with ACPC
1PB8 1.45 Å, Crystal structure of the NR1 ligand binding core in complex with D-serine at 1.45 Å…
1Y1Z 1.5 Å, Crystal structure of the NR1 ligand binding core in complex with ACBC
5U8C 1.6 Å, Crystal structure of GLUN1/GLUN2A ligand-binding domain in complex with glycine and…
1PB9 1.6 Å, Crystal structure of the NR1 ligand binding core in complex with D-cycloserine at 1.60 Å…
5I57 1.7 Å, Glutamate- and glycine-bound GluN1/GluN2A agonist binding domains
9NYZ 1.71 Å, Crystal structure of DCKA/glutamate-bound GluN1/GluN2A agonist binding domains with…
1Y1M 1.8 Å, Crystal structure of the NR1 ligand binding core in complex with cycloleucine
4NF8 1.86 Å, Crystal structure of GluN1/GluN2A ligand-binding domain in complex with glycine and…
6UZR 1.87 Å, Crystal structure of GLUN1/GLUN2A ligand-binding domain in complex with glycine and…
4KCC 1.89 Å, Crystal Structure of the NMDA Receptor GluN1 Ligand Binding Domain Apo State

Browse structure collections

About this viewer

MolViewer shows 6UZ6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.