6V3K: HIV cleaved synaptic complex (CSC) intasome

Structure of HIV cleaved synaptic complex (CSC) intasome bound with magnesium and INSTI XZ419 (compound 4c). Determined by electron microscopy at 3.4 Å resolution. Released 12 Feb 2020.

Method: Electron microscopy
Resolution: 3.4 Å
Organisms: Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2), Human immunodeficiency virus 1
Chains: 6
Atoms: 5,657
Mol. weight: 185.86 kDa
Ligands: ZN, QUW, MG
Released: 12 Feb 2020

Explore 6V3K in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6V3K contains 25 α-helices and 32 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	2-15	14
α-helix	19-25	7
α-helix	30-37	8
β-strand	60-68	9	1
β-strand	71-78	8	1
β-strand	84-89	6	1
α-helix	94-107	14
β-strand	112-115	4	1
α-helix	119-122	4
α-helix	124-132	9
α-helix	135	1
β-strand	136-139	4	1
α-helix	145-148	4
α-helix	149-165	17
α-helix	166-168	3
α-helix	173-185	13
α-helix	196-220	25
β-strand	224-226	3	2
β-strand	239-244	6	2
β-strand	249-252	4	2
β-strand	257-260	4	2
β-strand	266-267	2	2

Chain B: 10 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	2-15	14
α-helix	19-26	8
α-helix	30-38	9
β-strand	60-68	9	3
β-strand	71-78	8	3
β-strand	84-89	6	3
α-helix	94-107	14
β-strand	112-114	3	3
α-helix	124-132	9
β-strand	136-138	3	3
α-helix	151-165	15
α-helix	166-168	3
α-helix	173-185	13
α-helix	196-221	26
β-strand	223-227	5	4
β-strand	238-239	2	4
β-strand	240-244	5	5
β-strand	248-253	6	5
β-strand	256-261	6	5
α-helix	262-264	3
β-strand	265-269	5	4

Chain C: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	214-220	7
β-strand	224-227	4	6
β-strand	239-244	6	6
β-strand	248-253	6	6
β-strand	256-261	6	6
α-helix	262-264	3
β-strand	265-268	4	6

Chain D: 1 helix, 6 β-strands

Element	Residues	Length	Sheet
β-strand	225-227	3	7
β-strand	236-239	4	7
β-strand	240-245	6	8
β-strand	248-253	6	8
β-strand	256-261	6	8
α-helix	262-264	3
β-strand	265-267	3	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Chimeric Sso7d and HIV-1 integrase	A, B, C, D	protein	383	Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2), Human immunodeficiency virus 1	P12497, P39476 (AlphaFold model)
viral DNA non-transferred strand	E	DNA	27	Human immunodeficiency virus 1
viral DNA transferred strand	F	DNA	25	Human immunodeficiency virus 1

Sequence of entity 1 (A, B, C, D), FASTA

>6V3K_1 Chimeric Sso7d and HIV-1 integrase (chains A, B, C, D)
MGSSHHHHHHSSGLVPRGSHMATVKFKYKGEEKEVDISKIKKVWRVGKMISFTYDEGGGK
TGRGAVSEKDAPKELLQMLEKQKKGGGGGGGGGGGFLDGIDKAQEEHEKYHSNWRAMASD
FNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIE
AEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNP
QSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIA
TDIQTKELQKQITKIQNFRVYYRDSRDPVWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKA
KIIRDYGKQMAGDDCVASRQDED

Sequence of entity 2 (E), FASTA

>6V3K_2 viral DNA non-transferred strand (chains E)
ACTGCTAGAGATTTTCCCGCCCACGCT

Sequence of entity 3 (F), FASTA

>6V3K_3 viral DNA transferred strand (chains F)
AGCGTGGGCGGGAAAATCTCTAGCA

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2
QUW	4-azanyl-N-[[2,4-bis(fluoranyl)phenyl]methyl]-1-oxidanyl-2-oxidanylidene-6-(5-o…	C21 H22 F2 N4 O4	1
MG	Magnesium ion	Mg	2

Primary citation

Structural basis for strand-transfer inhibitor binding to HIV intasomes. Passos, D.O., Li, M., Jozwik, I.K. et al. Science (2020) 367:810-814. DOI 10.1126/science.aay8015 · PubMed

Other PDB entries of the same protein (UniProt P12497), best resolution first:

3DS4 1.12 Å, HIV-1 capsid C-terminal domain mutant (L211S) in complex with an inhibitor of particle…
3DS2 1.2 Å, HIV-1 capsid C-terminal domain mutant (Y169A)
6T6E 1.3 Å, Crystal Structure of the C-terminal domain of the HIV-1 Integrase (PNL4-3)
2XDE 1.4 Å, Crystal structure of the complex of PF-3450074 with an engineered HIV capsid N terminal…
3L3U 1.4 Å, Crystal structure of the HIV-1 integrase core domain to 1.4A
2PWO 1.45 Å, Crystal Structure of HIV-1 CA146 A92E Psuedo Cell
3WNF 1.45 Å, Cyclic hexapeptide CKIDNC in complex with HIV-1 integrase
6OYD 1.46 Å, X-ray crystal structure of wild type HIV-1 protease in complex with GRL-004
6MCR 1.48 Å, X-ray crystal structure of wild type HIV-1 protease in complex with GRL-001
2PXR 1.5 Å, Crystal Structure of HIV-1 CA146 in the Presence of CAP-1
3WNH 1.5 Å, Cyclic hexapeptide PKZDNv in complex with HIV-1 integrase
4NX4 1.5 Å, Re-refinement of CAP-1 HIV-CA complex

Browse structure collections

About this viewer

MolViewer shows 6V3K directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.