Crystal structure of monomeric human protocadherin 10 EC1-EC4. Determined by X-ray diffraction at 2.3 Å resolution. Released 11 Mar 2020.
Explore 6VFQ in 3D Show helices and sheets RCSB PDB PDBe
6VFQ contains 16 α-helices and 33 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-8 | 6 | 1 |
| β-strand | 16-19 | 4 | 2 |
| α-helix | 20-24 | 5 | |
| α-helix | 28-31 | 4 | |
| β-strand | 37-38 | 2 | 1 |
| α-helix | 40-42 | 3 | |
| β-strand | 47-50 | 4 | 2 |
| β-strand | 55-58 | 4 | 2 |
| α-helix | 61-62 | 2 | |
| α-helix | 64-68 | 5 | |
| β-strand | 75-82 | 8 | 1 |
| β-strand | 87-96 | 10 | 1 |
| α-helix | 97 | 1 | |
| β-strand | 104 | 1 | 3 |
| β-strand | 109-115 | 7 | 4 |
| α-helix | 118-119 | 2 | |
| β-strand | 123-125 | 3 | 5 |
| α-helix | 127-129 | 3 | |
| β-strand | 130 | 1 | 3 |
| α-helix | 135-137 | 3 | |
| β-strand | 139-144 | 6 | 4 |
| β-strand | 150-158 | 9 | 5 |
| β-strand | 161-168 | 8 | 5 |
| β-strand | 179-188 | 10 | 4 |
| α-helix | 207-212 | 6 | |
| β-strand | 214-224 | 11 | 4 |
| α-helix | 225 | 1 | |
| β-strand | 232-233 | 2 | 6 |
| β-strand | 237-243 | 7 | 7 |
| α-helix | 246-247 | 2 | |
| β-strand | 251-254 | 4 | 8 |
| β-strand | 257-258 | 2 | 6 |
| α-helix | 263-266 | 4 | |
| β-strand | 268-272 | 5 | 7 |
| α-helix | 278-283 | 6 | |
| β-strand | 284-286 | 3 | 8 |
| β-strand | 292-295 | 4 | 8 |
| β-strand | 306-315 | 10 | 7 |
| β-strand | 323-332 | 10 | 7 |
| β-strand | 340-346 | 7 | 9 |
| β-strand | 349-350 | 2 | 10 |
| α-helix | 354-355 | 2 | |
| β-strand | 359-366 | 8 | 9 |
| α-helix | 371-374 | 4 | |
| β-strand | 376-380 | 5 | 10 |
| β-strand | 386-392 | 7 | 9 |
| β-strand | 395-400 | 6 | 9 |
| β-strand | 411-420 | 10 | 10 |
| β-strand | 427-436 | 10 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protocadherin-10 | A | protein | 444 | Homo sapiens | Q9P2E7 (AlphaFold model) |
>6VFQ_1 Protocadherin-10 (chains A) SQLHYTVQEEQEHGTFVGNIAEDLGLDITKLSARGFQTVPNSRTPYLDLNLETGVLYVNE KIDREQICKQSPSCVLHLEVFLENPLELFQVEIEVLDINDNPPSFPEPDLTVEISESATP GTRFPLESAFDPDVGTNSLRDYEITPNSYFSLDVQTQGDGNRFAELVLEKPLDREQQAVH RYVLTAVDGGGGGGVGEGGGGGGGAGLPPQQQRTGTALLTIRVLDSNDNVPAFDQPVYTV SLPENSPPGTLVIQLNATDPDEGQNGEVVYSFSSHISPRARELFGLSPRTGRLEVSGELD YEESPVYQVYVQAKDLGPNAVPAHCKVLVRVLDANDNAPEISFSTVKEAVSEGAAPGTVV ALFSVTDRDSEENGQVQCELLGDVPFRLKSSFKNYYTIVTEAPLDREAGDSYTLTVVARD RGEPALSTSKSIQVQVSDHHHHHH
Water and common crystallization additives (ACT, EDO) are not listed.
Family-wide Structural and Biophysical Analysis of Binding Interactions among Non-clustered delta-Protocadherins. Harrison, O.J., Brasch, J., Katsamba, P.S. et al. Cell Rep (2020) 30:2655-2671.e7. DOI 10.1016/j.celrep.2020.02.003 · PubMed
Other PDB entries of the same protein (UniProt Q9P2E7 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6VFQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.