Cryo-EM structure of stabilized HIV-1 Env trimer CAP256.wk34.c80 SOSIP.RnS2. Determined by electron microscopy at 3.71 Å resolution. Released 11 Mar 2020.
Explore 6VRW in 3D Show helices and sheets RCSB PDB PDBe
6VRW contains 50 α-helices and 138 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 35-40 | 6 | 14 |
| β-strand | 45-47 | 3 | 15 |
| β-strand | 53-56 | 4 | 16 |
| β-strand | 67 | 1 | 17 |
| β-strand | 75-76 | 2 | 16 |
| α-helix | 77-78 | 2 | |
| β-strand | 83-85 | 3 | 15 |
| β-strand | 91-93 | 3 | 18 |
| α-helix | 102-115 | 14 | |
| β-strand | 121 | 1 | 19 |
| β-strand | 130-131 | 2 | 20 |
| β-strand | 154-162 | 9 | 20 |
| β-strand | 169-177 | 9 | 20 |
| α-helix | 178-180 | 3 | |
| β-strand | 181-183 | 3 | 21 |
| β-strand | 191-193 | 3 | 21 |
| β-strand | 202-203 | 2 | 19 |
| β-strand | 209 | 1 | 17 |
| β-strand | 215 | 1 | 22 |
| β-strand | 216-218 | 3 | 16 |
| α-helix | 219-220 | 2 | |
| β-strand | 221 | 1 | 15 |
| β-strand | 223-228 | 6 | 15 |
| β-strand | 237-239 | 3 | 18 |
| β-strand | 242-245 | 4 | 15 |
| β-strand | 247 | 1 | 16 |
| β-strand | 251 | 1 | 22 |
| β-strand | 256 | 1 | 23 |
| β-strand | 261 | 1 | 24 |
| α-helix | 263-265 | 3 | |
| β-strand | 272-273 | 2 | 25 |
| β-strand | 284-286 | 3 | 25 |
| α-helix | 291 | 1 | |
| β-strand | 292-298 | 7 | 24 |
| β-strand | 301-312 | 10 | 20 |
| β-strand | 315-323 | 10 | 20 |
| β-strand | 330-333 | 4 | 24 |
| α-helix | 336-350 | 15 | |
| β-strand | 360-361 | 2 | 25 |
| β-strand | 374-378 | 5 | 23 |
| β-strand | 381-385 | 5 | 23 |
| β-strand | 414-417 | 4 | 24 |
| β-strand | 418-421 | 4 | 23 |
| β-strand | 423-424 | 2 | 19 |
| α-helix | 426-428 | 3 | |
| β-strand | 434-435 | 2 | 19 |
| α-helix | 436-438 | 3 | |
| β-strand | 443-449 | 7 | 24 |
| β-strand | 452-456 | 5 | 25 |
| β-strand | 467-470 | 4 | 25 |
| α-helix | 476-479 | 4 | |
| β-strand | 486-491 | 6 | 15 |
| β-strand | 494-499 | 6 | 14 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 517-521 | 5 | |
| β-strand | 529 | 1 | 13 |
| α-helix | 571-594 | 24 | |
| β-strand | 605-609 | 5 | 1 |
| α-helix | 619-624 | 6 | |
| β-strand | 627 | 1 | 13 |
| α-helix | 628-634 | 7 | |
| α-helix | 639-653 | 15 | |
| α-helix | 654-659 | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 517-521 | 5 | |
| β-strand | 529 | 1 | 26 |
| α-helix | 530-533 | 4 | |
| α-helix | 571-594 | 24 | |
| β-strand | 605-609 | 5 | 14 |
| α-helix | 619-624 | 6 | |
| β-strand | 627 | 1 | 26 |
| α-helix | 628-634 | 7 | |
| α-helix | 639-653 | 15 | |
| α-helix | 654-659 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Envelope glycoprotein gp120 | A, D, G | protein | 471 | Human immunodeficiency virus 1 | A0A0N9FF17 |
| Envelope glycoprotein gp41 | B, C, E | protein | 154 | Human immunodeficiency virus 1 |
>6VRW_1 Envelope glycoprotein gp120 (chains A, D, G) GLWVTVYYGVPVWREAKTTLFCASDAKSYEKEVHNVWATHACVPTDPNPQELVLENVTEN FNMWKNDMVDQMHEDIISLWDQSLKPCVKLTPLCVTLNCSDAKVNATYKGTREEIKNCSF NATTELRDKKRREYALFYRLDIVPLSGEGNNNSEYRLINCNTSVITQICPKVTFDPIPIH YCAPAGYAILKCNNKTFNGTGPCNNVSTVQCTHGIKPVVSTQLLLNGSLAEEEIIIRSEN LTDNVKTIIVHLNESVEITCTRPNNMTRKSVRIGPGQTFYALGDIIGDIRQPHCNISEIK WEKTLQRVSEKLREHFNKTIIFNQSSGGDLEITTHSFNCGGEFFYCNTSDLFFNKTFNET YSTGSNSTNSTITLPCRIKQIINMWQEVGRAMYAPPIAGNITCKSNITGLLLTRDGGGNN STKETFRPGGGNMRDNWRSELYKYKVVEVKPLGIAPTECNRTVVQRRRRRR
>6VRW_2 Envelope glycoprotein gp41 (chains B, C, E) AVVGLGAVFLGFLGAAGSTMGAASNTLTVQARQLLSGIVQQQSNLLRAPEAQQHMLQLGV WGFKQLQARVLAIERYLEVQQLLGMWGCSGKLICCTNVPWNSSWSNKTYNEIWDNMTWMQ WDREIGNYTDTIYKLLEVSQFQQEINEKDNLTLD
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 39 |
Structure of Super-Potent Antibody CAP256-VRC26.25 in Complex with HIV-1 Envelope Reveals a Combined Mode of Trimer-Apex Recognition. Gorman, J., Chuang, G.Y., Lai, Y.T. et al. Cell Rep (2020) 31:107488-107488. DOI 10.1016/j.celrep.2020.03.052 · PubMed
Other PDB entries of the same protein (UniProt A0A0N9FF17), best resolution first:
MolViewer shows 6VRW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.