DH717.1 Fab monomer in complex with man9 glycan. Determined by X-ray diffraction at 2.61 Å resolution. Released 30 Dec 2020.
Explore 6VTU in 3D Show helices and sheets RCSB PDB PDBe
6VTU contains 18 α-helices and 48 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-7 | 5 | 1 |
| β-strand | 11-12 | 2 | 2 |
| α-helix | 17 | 1 | |
| β-strand | 18-25 | 8 | 1 |
| β-strand | 34-39 | 7 | 3 |
| β-strand | 46-52 | 7 | 3 |
| β-strand | 57-59 | 3 | 3 |
| β-strand | 67-72 | 6 | 1 |
| β-strand | 77-82 | 6 | 1 |
| α-helix | 84-86 | 3 | |
| β-strand | 88-95 | 8 | 3 |
| α-helix | 96 | 1 | |
| α-helix | 100B-100D | 3 | |
| β-strand | 100F-103 | 4 | 3 |
| β-strand | 107-109 | 3 | 3 |
| β-strand | 110-111 | 2 | 2 |
| α-helix | 115-116 | 2 | |
| β-strand | 117 | 1 | 4 |
| β-strand | 120-124 | 5 | 5 |
| β-strand | 130-140 | 11 | 5 |
| β-strand | 141 | 1 | 4 |
| β-strand | 146-149 | 4 | 6 |
| α-helix | 150-152 | 3 | |
| β-strand | 154 | 1 | 6 |
| β-strand | 158-160 | 3 | 5 |
| α-helix | 161-163 | 3 | |
| β-strand | 164-165 | 2 | 5 |
| α-helix | 166 | 1 | |
| β-strand | 171-180 | 10 | 5 |
| α-helix | 181-183 | 3 | |
| β-strand | 190-195 | 6 | 6 |
| α-helix | 196-198 | 3 | |
| β-strand | 200-205 | 6 | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2-3 | 2 | |
| β-strand | 4 | 1 | 7 |
| β-strand | 5 | 1 | 8 |
| β-strand | 9-13 | 4 | 9 |
| β-strand | 19-24 | 6 | 8 |
| β-strand | 33-38 | 6 | 9 |
| β-strand | 45-48 | 4 | 9 |
| β-strand | 49 | 1 | 10 |
| β-strand | 53 | 1 | 10 |
| β-strand | 62-67 | 6 | 8 |
| β-strand | 70-75 | 6 | 8 |
| α-helix | 80-82 | 3 | |
| β-strand | 85-92 | 8 | 9 |
| β-strand | 95A-98 | 4 | 9 |
| β-strand | 99 | 1 | 7 |
| β-strand | 102-106 | 5 | 9 |
| α-helix | 108-110 | 3 | |
| β-strand | 111 | 1 | 11 |
| α-helix | 112-113 | 2 | |
| β-strand | 114-118 | 5 | 12 |
| α-helix | 119-121 | 3 | |
| α-helix | 122-125 | 4 | |
| β-strand | 130-139 | 10 | 12 |
| β-strand | 140 | 1 | 11 |
| β-strand | 145-150 | 6 | 13 |
| β-strand | 153-155 | 3 | 13 |
| β-strand | 159-161 | 3 | 12 |
| α-helix | 162-164 | 3 | |
| β-strand | 165-166 | 2 | 12 |
| β-strand | 172-180 | 9 | 12 |
| α-helix | 182-186 | 5 | |
| β-strand | 191-196 | 6 | 13 |
| β-strand | 201-206 | 6 | 13 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| DH717.1 heavy chain | H | protein | 225 | Homo sapiens | S6B291 (AlphaFold model) |
| DH717.1 light chain | L | protein | 216 | Homo sapiens | Q6IPQ0 (AlphaFold model) |
>6VTU_1 DH717.1 heavy chain (chains H) QVQLQESGPGLVKPSETLSLTCAVSGVSINDGYDWTWIRQTPGKGLEWIGYVFGRSGNFN LNPSLRNRGIISKDTCKNQFSLNLNSATAADTAVYFCARGMEGLFAAYNSLDVWGRGLLV TVSGASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAV LQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
>6VTU_2 DH717.1 light chain (chains L) QAALTQPPSVSGSPGQSVIISCTGTSSDIGQYNSVSWYQQHPDKAPKLVIYGVTSRPSGV SDRFSGSKYGDTASLTISGLQAEDEADYYCSSHADENMALFGGGTRLTVLGQPKGAPSVT LFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASS YLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Fab-dimerized glycan-reactive antibodies are a structural category of natural antibodies. Williams, W.B., Meyerhoff, R.R., Edwards, R.J. et al. Cell (2021) 184:2955. DOI 10.1016/j.cell.2021.04.042 · PubMed
Other PDB entries of the same protein (UniProt S6B291 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6VTU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.