6VYL: Mechanosensitive channel MscS in PC-10 nanodiscs

Cryo-EM structure of mechanosensitive channel MscS in PC-10 nanodiscs. Determined by electron microscopy at 3.4 Å resolution. Released 10 Feb 2021.

Method: Electron microscopy
Resolution: 3.4 Å
Organism: Escherichia coli
Chains: 7
Atoms: 13,671
Mol. weight: 216.46 kDa
Released: 10 Feb 2021

Explore 6VYL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6VYL contains 56 α-helices and 105 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C and D: 8 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	28-59	32
α-helix	65-86	22
α-helix	93-110	18
α-helix	116-126	11
β-strand	135-137	3	1
β-strand	142-148	7	1
β-strand	152-157	6	1
β-strand	162-166	5	1
α-helix	167-170	4
β-strand	175-177	3	2
β-strand	183-185	3	3
β-strand	188-192	5	4
α-helix	198-211	14
β-strand	215	1	3
β-strand	222-228	7	4
β-strand	233-238	6	4
β-strand	240-242	3	3
α-helix	246-262	17
α-helix	268-270	3
β-strand	272-273	2	5
β-strand	274-275	2	6
β-strand	276	1	7
β-strand	278	1	8

Chain E: 8 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	28-59	32
α-helix	65-86	22
α-helix	93-110	18
α-helix	116-126	11
β-strand	135-137	3	19
β-strand	142-148	7	19
β-strand	152-157	6	19
β-strand	162-166	5	19
α-helix	167-170	4
β-strand	175-177	3	24
β-strand	183-185	3	25
β-strand	188-192	5	26
α-helix	198-211	14
β-strand	215	1	25
β-strand	222-228	7	26
β-strand	233-238	6	26
β-strand	240-242	3	25
α-helix	246-262	17
α-helix	268-270	3
β-strand	272-273	2	22
β-strand	274-275	2	27
β-strand	276	1	23
β-strand	278-279	2	28

Chain F: 8 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	28-59	32
α-helix	65-86	22
α-helix	93-110	18
α-helix	116-126	11
β-strand	135-137	3	24
β-strand	142-148	7	24
β-strand	152-157	6	24
β-strand	162-166	5	24
α-helix	167-170	4
β-strand	175-177	3	29
β-strand	183-185	3	30
β-strand	188-192	5	31
α-helix	198-211	14
β-strand	215	1	30
β-strand	222-228	7	31
β-strand	233-238	6	31
β-strand	240-242	3	30
α-helix	246-262	17
α-helix	268-270	3
β-strand	272-273	2	27
β-strand	274-275	2	32
β-strand	276-277	2	28
β-strand	278-279	2	33

Chain G: 8 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	28-59	32
α-helix	65-86	22
α-helix	93-110	18
α-helix	116-126	11
β-strand	135-137	3	29
β-strand	142-148	7	29
β-strand	152-157	6	29
β-strand	162-166	5	29
α-helix	167-170	4
β-strand	175-177	3	1
β-strand	183-185	3	34
β-strand	188-192	5	35
α-helix	198-211	14
β-strand	215	1	34
β-strand	222-228	7	35
β-strand	233-238	6	35
β-strand	240-242	3	34
α-helix	246-262	17
α-helix	268-270	3
β-strand	272-273	2	32
β-strand	274-275	2	5
β-strand	276-277	2	33
β-strand	278	1	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mechanosensitive channel MscS	A, B, C, D, E, F, G	protein	286	Escherichia coli	P0C0S1 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G), FASTA

>6VYL_1 Mechanosensitive channel MscS (chains A, B, C, D, E, F, G)
MEDLNVVDSINGAGSWLVANQALLLSYAVNIVAALAIIIVGLIIARMISNAVNRLMISRK
IDATVADFLSALVRYGIIAFTLIAALGRVGVQTASVIAVLGAAGLAVGLALQGSLSNLAA
GVLLVMFRPFRAGEYVDLGGVAGTVLSVQIFSTTMRTADGKIIVIPNGKIIAGNIINFSR
EPVRRNEFIIGVAYDSDIDQVKQILTNIIQSEDRILKDREMTVRLNELGASSINFVVRVW
SNSGDLQNVYWDVLERIKREFDAAGISFPYPQMDVNFKRVKEDKAA

Primary citation

Visualization of the mechanosensitive ion channel MscS under membrane tension. Zhang, Y., Daday, C., Gu, R.X. et al. Nature (2021) 590:509-514. DOI 10.1038/s41586-021-03196-w · PubMed

Other PDB entries of the same protein (UniProt P0C0S1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7ONJ 2.3 Å, Mechanosensitive channel MscS solubilized with LMNG in open conformation
9E68 2.5 Å, Cryo-EM structure of MscS/YnaI chimera in DOPC nanodiscs
7OOA 2.7 Å, Mechanosensitive channel MscS solubilized with LMNG in open conformation with added lipid
9H2S 2.7 Å, a YnaI-MscS chimera in a closed conformation purified in DDM with additional lipids…
9H2V 2.8 Å, a YnaI-MscS chimera in an open conformation purified in DDM showing ligand-filled pockets
6RLD 2.9 Å, Structure of the mechanosensitive channel mscs embedded in the membrane bilayer
5AJI 2.99 Å, MscS D67R1 high resolution
6PWN 3.1 Å, MscS Nanodisc with N-terminal His-Tag
7OO0 3.1 Å, Mechanosensitive channel MscS solubilized with DDM in open conformation
7OO6 3.1 Å, Mechanosensitive channel MscS solubilized with DDM in closed conformation with added lipid
8DDJ 3.1 Å, Open MscS in PC14.1 Nanodiscs
6VYK 3.2 Å, Cryo-EM structure of mechanosensitive channel MscS in PC-18:1 nanodiscs

Browse structure collections

About this viewer

MolViewer shows 6VYL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.