6W1T: Photosystem II protein D1 1
RT XFEL structure of Photosystem II 250 microseconds after the second illumination at 2.01 Angstrom resolution. Determined by X-ray diffraction at 2.01 Å resolution. Released 13 May 2020.
- Method
- X-ray diffraction
- Resolution
- 2.01 Å
- Organism
- Thermosynechococcus elongatus (strain BP-1)
- Chains
- 40
- Atoms
- 53,425
- Mol. weight
- 757.43 kDa
- Ligands
- FE2, CLA, PHO, BCR
- Released
- 13 May 2020
Explore 6W1T in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
6W1T contains 302 α-helices and 179 β-strands across 40 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain a: 23 helices, 11 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 13-21 | 9 | |
| α-helix | 31-54 | 24 | |
| α-helix | 55-57 | 3 | |
| β-strand | 58 | 1 | 45 |
| α-helix | 66 | 1 | |
| β-strand | 67 | 1 | 45 |
| α-helix | 68 | 1 | |
| α-helix | 71-73 | 3 | |
| β-strand | 81-82 | 2 | 46 |
| α-helix | 83-86 | 4 | |
| α-helix | 96-98 | 3 | |
| α-helix | 102-107 | 6 | |
| α-helix | 110-136 | 27 | |
| α-helix | 143-155 | 13 | |
| α-helix | 156-160 | 5 | |
| α-helix | 161-165 | 5 | |
| α-helix | 168-170 | 3 | |
| α-helix | 172-173 | 2 | |
| β-strand | 174-175 | 2 | 46 |
| α-helix | 176-190 | 15 | |
| α-helix | 196-220 | 25 | |
| β-strand | 223 | 1 | 47 |
| β-strand | 224 | 1 | 48 |
| α-helix | 225 | 1 | |
| α-helix | 233-236 | 4 | |
| β-strand | 243 | 1 | 49 |
| β-strand | 246 | 1 | 47 |
| α-helix | 248-258 | 11 | |
| α-helix | 261-263 | 3 | |
| α-helix | 268-293 | 26 | |
| β-strand | 297-298 | 2 | 50 |
| β-strand | 307 | 1 | 51 |
| β-strand | 313 | 1 | 51 |
| α-helix | 317-331 | 15 | |
Chain A: 22 helices, 11 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 13-21 | 9 | |
| α-helix | 31-54 | 24 | |
| β-strand | 58 | 1 | 1 |
| α-helix | 66 | 1 | |
| β-strand | 67 | 1 | 1 |
| α-helix | 68 | 1 | |
| α-helix | 71-73 | 3 | |
| β-strand | 81-82 | 2 | 2 |
| α-helix | 83-86 | 4 | |
| α-helix | 96-98 | 3 | |
| α-helix | 102-108 | 7 | |
| α-helix | 110-137 | 28 | |
| α-helix | 143-155 | 13 | |
| α-helix | 156-160 | 5 | |
| α-helix | 161-165 | 5 | |
| α-helix | 168-170 | 3 | |
| α-helix | 172-173 | 2 | |
| β-strand | 174-175 | 2 | 2 |
| α-helix | 176-190 | 15 | |
| α-helix | 192-194 | 3 | |
| α-helix | 196-221 | 26 | |
| β-strand | 223 | 1 | 3 |
| β-strand | 224 | 1 | 4 |
| α-helix | 233-236 | 4 | |
| β-strand | 243 | 1 | 5 |
| β-strand | 246 | 1 | 3 |
| α-helix | 248-258 | 11 | |
| α-helix | 261-263 | 3 | |
| α-helix | 268-293 | 26 | |
| β-strand | 297-298 | 2 | 6 |
| β-strand | 307 | 1 | 7 |
| β-strand | 313 | 1 | 7 |
| α-helix | 317-331 | 15 | |
Chain b: 27 helices, 28 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 3-4 | 2 | 52 |
| α-helix | 5-12 | 8 | |
| α-helix | 16-44 | 29 | |
| α-helix | 55-57 | 3 | |
| α-helix | 63-68 | 6 | |
| β-strand | 73 | 1 | 53 |
| β-strand | 78 | 1 | 54 |
| β-strand | 79 | 1 | 53 |
| β-strand | 84 | 1 | 54 |
| α-helix | 93-116 | 24 | |
| β-strand | 120 | 1 | 55 |
| α-helix | 121-123 | 3 | |
| β-strand | 124 | 1 | 56 |
| β-strand | 131 | 1 | 56 |
| α-helix | 135-152 | 18 | |
| α-helix | 153-158 | 6 | |
| β-strand | 166-168 | 3 | 57 |
| β-strand | 177-179 | 3 | 57 |
| α-helix | 187-190 | 4 | |
| α-helix | 195-218 | 24 | |
| α-helix | 220-221 | 2 | |
| β-strand | 222 | 1 | 58 |
| α-helix | 223-229 | 7 | |
| α-helix | 234-258 | 25 | |
| α-helix | 265-268 | 4 | |
| α-helix | 272-276 | 5 | |
| α-helix | 279-293 | 15 | |
| α-helix | 298-303 | 6 | |
| α-helix | 307-312 | 6 | |
| β-strand | 314 | 1 | 59 |
| α-helix | 315-317 | 3 | |
| β-strand | 323 | 1 | 60 |
| α-helix | 330-332 | 3 | |
| β-strand | 336-342 | 7 | 61 |
| β-strand | 343-347 | 5 | 62 |
| β-strand | 353-354 | 2 | 62 |
| β-strand | 355-356 | 2 | 63 |
| α-helix | 357-360 | 4 | |
| β-strand | 369-371 | 3 | 63 |
| β-strand | 377-380 | 4 | 63 |
| β-strand | 391 | 1 | 63 |
| α-helix | 392-395 | 4 | |
| β-strand | 398-402 | 5 | 62 |
| β-strand | 410-411 | 2 | 62 |
| α-helix | 414-424 | 11 | |
| β-strand | 427 | 1 | 59 |
| β-strand | 429-433 | 5 | 61 |
| α-helix | 447-474 | 28 | |
| α-helix | 476-478 | 3 | |
| β-strand | 482 | 1 | 48 |
| α-helix | 488-491 | 4 | |
| β-strand | 496 | 1 | 64 |
| β-strand | 498 | 1 | 65 |
| α-helix | 502-504 | 3 | |
| β-strand | 505 | 1 | 64 |
Chain B: 27 helices, 27 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 3 | 1 | 8 |
| α-helix | 5-12 | 8 | |
| α-helix | 16-44 | 29 | |
| α-helix | 55-57 | 3 | |
| α-helix | 63-68 | 6 | |
| β-strand | 73 | 1 | 9 |
| β-strand | 78 | 1 | 10 |
| β-strand | 79 | 1 | 9 |
| β-strand | 84 | 1 | 10 |
| α-helix | 93-116 | 24 | |
| β-strand | 120 | 1 | 11 |
| α-helix | 121-123 | 3 | |
| β-strand | 124 | 1 | 12 |
| β-strand | 131 | 1 | 12 |
| α-helix | 135-152 | 18 | |
| α-helix | 153-158 | 6 | |
| β-strand | 166-168 | 3 | 13 |
| β-strand | 177-179 | 3 | 13 |
| α-helix | 187-190 | 4 | |
| α-helix | 195-218 | 24 | |
| α-helix | 220-221 | 2 | |
| β-strand | 222 | 1 | 14 |
| α-helix | 223-228 | 6 | |
| α-helix | 234-258 | 25 | |
| α-helix | 265-268 | 4 | |
| α-helix | 272-276 | 5 | |
| α-helix | 279-293 | 15 | |
| α-helix | 298-303 | 6 | |
| α-helix | 307-312 | 6 | |
| β-strand | 314 | 1 | 15 |
| α-helix | 315-317 | 3 | |
| β-strand | 323 | 1 | 16 |
| α-helix | 330-332 | 3 | |
| β-strand | 336-342 | 7 | 17 |
| β-strand | 343-347 | 5 | 18 |
| β-strand | 353-354 | 2 | 18 |
| β-strand | 355-356 | 2 | 19 |
| α-helix | 357-360 | 4 | |
| β-strand | 369-371 | 3 | 19 |
| β-strand | 377-380 | 4 | 19 |
| α-helix | 392-395 | 4 | |
| β-strand | 398-402 | 5 | 18 |
| β-strand | 410-411 | 2 | 18 |
| α-helix | 414-424 | 11 | |
| β-strand | 427 | 1 | 15 |
| β-strand | 429-433 | 5 | 17 |
| α-helix | 447-474 | 28 | |
| α-helix | 476-478 | 3 | |
| β-strand | 482 | 1 | 4 |
| α-helix | 488-491 | 4 | |
| β-strand | 496 | 1 | 20 |
| β-strand | 498 | 1 | 21 |
| α-helix | 502-504 | 3 | |
| β-strand | 505 | 1 | 20 |
Chain c: 26 helices, 15 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 28-31 | 4 | |
| α-helix | 35-42 | 8 | |
| α-helix | 46-73 | 28 | |
| α-helix | 81-83 | 3 | |
| α-helix | 89-94 | 6 | |
| β-strand | 99 | 1 | 66 |
| α-helix | 101-103 | 3 | |
| β-strand | 105 | 1 | 66 |
| α-helix | 109-130 | 22 | |
| α-helix | 131-135 | 5 | |
| α-helix | 154-180 | 27 | |
| β-strand | 185-187 | 3 | 67 |
| β-strand | 195-197 | 3 | 67 |
| α-helix | 206-209 | 4 | |
| α-helix | 211-214 | 4 | |
| α-helix | 223-226 | 4 | |
| α-helix | 230-253 | 24 | |
| α-helix | 258-263 | 6 | |
| α-helix | 268-292 | 25 | |
| α-helix | 299-302 | 4 | |
| α-helix | 306-324 | 19 | |
| β-strand | 332 | 1 | 68 |
| β-strand | 338 | 1 | 68 |
| β-strand | 341-343 | 3 | 69 |
| β-strand | 349-351 | 3 | 69 |
| α-helix | 353-358 | 6 | |
| α-helix | 367-369 | 3 | |
| β-strand | 370-371 | 2 | 69 |
| β-strand | 374-375 | 2 | 69 |
| α-helix | 377-382 | 6 | |
| α-helix | 386-396 | 11 | |
| β-strand | 402-403 | 2 | 50 |
| β-strand | 407 | 1 | 70 |
| β-strand | 408 | 1 | 50 |
| α-helix | 413-414 | 2 | |
| β-strand | 418 | 1 | 70 |
| α-helix | 422-453 | 32 | |
| β-strand | 459 | 1 | 71 |
| α-helix | 461-463 | 3 | |
| α-helix | 465-468 | 4 | |
| α-helix | 470-471 | 2 | |
Chain C: 24 helices, 15 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 35-42 | 8 | |
| α-helix | 46-74 | 29 | |
| α-helix | 81-83 | 3 | |
| α-helix | 89-94 | 6 | |
| β-strand | 99 | 1 | 22 |
| α-helix | 101-103 | 3 | |
| β-strand | 105 | 1 | 22 |
| α-helix | 109-130 | 22 | |
| α-helix | 131-135 | 5 | |
| α-helix | 154-181 | 28 | |
| β-strand | 185-187 | 3 | 23 |
| β-strand | 195-197 | 3 | 23 |
| α-helix | 206-213 | 8 | |
| α-helix | 223-226 | 4 | |
| α-helix | 230-253 | 24 | |
| α-helix | 258-263 | 6 | |
| α-helix | 268-292 | 25 | |
| α-helix | 299-302 | 4 | |
| α-helix | 306-323 | 18 | |
| β-strand | 332 | 1 | 24 |
| β-strand | 338 | 1 | 24 |
| β-strand | 341-343 | 3 | 25 |
| β-strand | 349-351 | 3 | 25 |
| α-helix | 353-358 | 6 | |
| α-helix | 367-369 | 3 | |
| β-strand | 370-371 | 2 | 25 |
| β-strand | 374-375 | 2 | 25 |
| α-helix | 377-382 | 6 | |
| α-helix | 386-396 | 11 | |
| β-strand | 402-403 | 2 | 6 |
| β-strand | 407 | 1 | 26 |
| β-strand | 408 | 1 | 6 |
| α-helix | 413-414 | 2 | |
| β-strand | 418 | 1 | 26 |
| α-helix | 422-453 | 32 | |
| β-strand | 459 | 1 | 27 |
| α-helix | 461-463 | 3 | |
| α-helix | 465-468 | 4 | |
| α-helix | 470-471 | 2 | |
Chain d: 23 helices, 10 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 14-22 | 9 | |
| β-strand | 24 | 1 | 65 |
| α-helix | 31-54 | 24 | |
| β-strand | 57 | 1 | 72 |
| α-helix | 58-61 | 4 | |
| β-strand | 63 | 1 | 72 |
| α-helix | 67-69 | 3 | |
| β-strand | 77-78 | 2 | 73 |
| α-helix | 79-82 | 4 | |
| α-helix | 83-85 | 3 | |
| α-helix | 101-107 | 7 | |
| α-helix | 109-136 | 28 | |
| α-helix | 141-153 | 13 | |
| α-helix | 154-159 | 6 | |
| α-helix | 160-163 | 4 | |
| α-helix | 167-169 | 3 | |
| β-strand | 173-174 | 2 | 73 |
| α-helix | 175-184 | 10 | |
| α-helix | 185-189 | 5 | |
| α-helix | 191-193 | 3 | |
| α-helix | 195-219 | 25 | |
| β-strand | 222 | 1 | 74 |
| β-strand | 223 | 1 | 71 |
| α-helix | 231-234 | 4 | |
| β-strand | 241 | 1 | 49 |
| β-strand | 244 | 1 | 74 |
| α-helix | 246-257 | 12 | |
| α-helix | 264-290 | 27 | |
| β-strand | 294 | 1 | 60 |
| α-helix | 299-307 | 9 | |
| α-helix | 314-333 | 20 | |
| α-helix | 335-337 | 3 | |
| α-helix | 343-345 | 3 | |
Chain D: 24 helices, 10 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 14-22 | 9 | |
| β-strand | 24 | 1 | 21 |
| α-helix | 31-54 | 24 | |
| β-strand | 57 | 1 | 28 |
| α-helix | 58-61 | 4 | |
| β-strand | 63 | 1 | 28 |
| α-helix | 67-69 | 3 | |
| β-strand | 77-78 | 2 | 29 |
| α-helix | 79-82 | 4 | |
| α-helix | 83-85 | 3 | |
| α-helix | 101-106 | 6 | |
| α-helix | 109-136 | 28 | |
| α-helix | 141-145 | 5 | |
| α-helix | 147-153 | 7 | |
| α-helix | 154-159 | 6 | |
| α-helix | 160-163 | 4 | |
| α-helix | 167-169 | 3 | |
| α-helix | 171-172 | 2 | |
| β-strand | 173-174 | 2 | 29 |
| α-helix | 175-189 | 15 | |
| α-helix | 191-193 | 3 | |
| α-helix | 195-220 | 26 | |
| β-strand | 222 | 1 | 30 |
| β-strand | 223 | 1 | 27 |
| α-helix | 231-234 | 4 | |
| β-strand | 241 | 1 | 5 |
| β-strand | 244 | 1 | 30 |
| α-helix | 246-257 | 12 | |
| α-helix | 264-290 | 27 | |
| β-strand | 294 | 1 | 16 |
| α-helix | 299-307 | 9 | |
| α-helix | 314-333 | 20 | |
| α-helix | 335-337 | 3 | |
| α-helix | 343-345 | 3 | |
28 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Photosystem II protein D1 1 | A, a | protein | 344 | Thermosynechococcus elongatus (strain BP-1) | P0A444 (AlphaFold model) |
| Photosystem II CP47 reaction center protein | B, b | protein | 506 | Thermosynechococcus elongatus (strain BP-1) | Q8DIQ1 (AlphaFold model) |
| Photosystem II CP43 reaction center protein | C, c | protein | 461 | Thermosynechococcus elongatus (strain BP-1) | Q8DIF8 (AlphaFold model) |
| Photosystem II D2 protein | D, d | protein | 352 | Thermosynechococcus elongatus (strain BP-1) | Q8CM25 (AlphaFold model) |
| Cytochrome b559 subunit alpha | E, e | protein | 84 | Thermosynechococcus elongatus (strain BP-1) | Q8DIP0 |
| Cytochrome b559 subunit beta | F, f | protein | 45 | Thermosynechococcus elongatus (strain BP-1) | Q8DIN9 |
| Photosystem II reaction center protein H | H, h | protein | 66 | Thermosynechococcus elongatus (strain BP-1) | Q8DJ43 |
| Photosystem II reaction center protein I | I, i | protein | 38 | Thermosynechococcus elongatus (strain BP-1) | Q8DJZ6 |
| Photosystem II reaction center protein J | J, j | protein | 40 | Thermosynechococcus elongatus (strain BP-1) | P59087 |
| Photosystem II reaction center protein K | K, k | protein | 46 | Thermosynechococcus elongatus (strain BP-1) | Q9F1K9 |
| Photosystem II reaction center protein L | L, l | protein | 37 | Thermosynechococcus elongatus (strain BP-1) | Q8DIN8 |
| Photosystem II reaction center protein M | M, m | protein | 36 | Thermosynechococcus elongatus (strain BP-1) | Q8DHA7 |
8 more molecules are not listed.
Sequence of entity 1 (A, a), FASTA
>6W1T_1 Photosystem II protein D1 1 (chains A, a)
MTTTLQRRESANLWERFCNWVTSTDNRLYVGWFGVIMIPTLLAATICFVIAFIAAPPVDI
DGIREPVSGSLLYGNNIITGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLIIFHFL
LGASCYMGRQWELSYRLGMRPWICVAYSAPLASAFAVFLIYPIGQGSFSDGMPLGISGTF
NFMIVFQAEHNILMHPFHQLGVAGVFGGALFCAMHGSLVTSSLIRETTETESANYGYKFG
QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGVWFTALGISTMAFNLNGF
NFNHSVIDAKGNVINTWADIINRANLGMEVMHERNAHNFPLDLA
Sequence of entity 2 (B, b), FASTA
>6W1T_2 Photosystem II CP47 reaction center protein (chains B, b)
MGLPWYRVHTVLINDPGRLIAAHLMHTALVAGWAGSMALYELATFDPSDPVLNPMWRQGM
FVLPFMARLGVTGSWSGWSITGETGIDPGFWSFEGVALAHIVLSGLLFLAACWHWVYWDL
ELFRDPRTGEPALDLPKMFGIHLFLAGLLCFGFGAFHLTGLFGPGMWVSDPYGLTGSVQP
VAPEWGPDGFNPYNPGGVVAHHIAAGIVGIIAGLFHILVRPPQRLYKALRMGNIETVLSS
SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDSSYFQQEINRRVQASLASGATLEE
AWSAIPEKLAFYDYIGNNPAKGGLFRTGPMNKGDGIAQAWKGHAVFRNKEGEELFVRRMP
AFFESFPVILTDKNGVVKADIPFRRAESKYSFEQQGVTVSFYGGELNGQTFTDPPTVKSY
ARKAIFGEIFEFDTETLNSDGIFRTSPRGWFTFAHAVFALLFFFGHIWHGARTLFRDVFS
GIDPELSPEQVEWGFYQKVGDVTTRR
Sequence of entity 3 (C, c), FASTA
>6W1T_3 Photosystem II CP43 reaction center protein (chains C, c)
MVTLSSNSIFATNRDQESSGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMTLFEL
AHFIPEKPMYEQGLILIPHIATLGWGVGPGGEVVDTFPFFVVGVVHLISSAVLGFGGVYH
AIRGPETLEEYSSFFGYDWKDKNKMTTILGFHLIVLGIGALLLVAKAMFFGGLYDTWAPG
GGDVRVITNPTLDPRVIFGYLLKSPFGGEGWIVSVNNLEDVVGGHIWIGLICIAGGIWHI
LTTPFGWARRAFIWSGEAYLSYSLGALSMMGFIATCFVWFNNTVYPSEFYGPTGPEASQA
QAMTFLIRDQKLGANVGSAQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRGP
NGLDLNKIKNDIQPWQERRAAEYMTHAPLGSLNSVGGVATEINSVNFVSPRSWLATSHFV
LAFFFLVGHLWHAGRARAAAAGFEKGIDRESEPVLSMPSLD
Sequence of entity 4 (D, d), FASTA
>6W1T_4 Photosystem II D2 protein (chains D, d)
MTIAIGRAPAERGWFDILDDWLKRDRFVFVGWSGILLFPCAYLALGGWLTGTTFVTSWYT
HGLASSYLEGCNFLTVAVSTPANSMGHSLLLLWGPEAQGDFTRWCQLGGLWTFIALHGAF
GLIGFMLRQFEIARLVGVRPYNAIAFSAPIAVFVSVFLIYPLGQSSWFFAPSFGVAAIFR
FLLFFQGFHNWTLNPFHMMGVAGVLGGALLCAIHGATVENTLFQDGEGASTFRAFNPTQA
EETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRSYDFIS
QEIRAAEDPEFETFYTKNLLLNEGIRAWMAPQDQPHENFVFPEEVLPRGNAL
Sequence of entity 5 (E, e), FASTA
>6W1T_5 Cytochrome b559 subunit alpha (chains E, e)
MAGTTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQ
RSIPLVTDRFEAKQQVETFLEQLK
Sequence of entity 6 (F, f), FASTA
>6W1T_6 Cytochrome b559 subunit beta (chains F, f)
MTSNTPNQEPVSYPIFTVRWVAVHTLAVPTIFFLGAIAAMQFIQR
Sequence of entity 7 (H, h), FASTA
>6W1T_7 Photosystem II reaction center protein H (chains H, h)
MARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNV
SWKALG
Sequence of entity 8 (I, i), FASTA
>6W1T_8 Photosystem II reaction center protein I (chains I, i)
METLKITVYIVVTFFVLLFVFGFLSGDPARNPKRKDLE
Sequence of entity 9 (J, j), FASTA
>6W1T_9 Photosystem II reaction center protein J (chains J, j)
MMSEGGRIPLWIVATVAGMGVIVIVGLFFYGAYAGLGSSL
Sequence of entity 10 (K, k), FASTA
>6W1T_10 Photosystem II reaction center protein K (chains K, k)
MIDALVLVAKLPEAYAIFDPLVDVLPVIPVLFLALAFVWQAAVGFR
Sequence of entity 11 (L, l), FASTA
>6W1T_11 Photosystem II reaction center protein L (chains L, l)
MEPNPNRQPVELNRTSLYLGLLLILVLALLFSSYFFN
Sequence of entity 12 (M, m), FASTA
>6W1T_12 Photosystem II reaction center protein M (chains M, m)
MEVNQLGLIATALFVLVPSVFLIILYVQTESQQKSS
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| FE2 | FE (II) ion | Fe | 2 |
| CLA | Chlorophyll a | C55 H72 Mg N4 O5 | 70 |
| PHO | Pheophytin a | C55 H74 N4 O5 | 4 |
| BCR | Beta-carotene | C40 H56 | 22 |
| PL9 | 2,3-dimethyl-5-(3,7,11,15,19,23,27,31,35-nonamethyl-2,6,10,14,18,22,26,30,34-he… | C53 H80 O2 | 4 |
| LMG | 1,2-distearoyl-monogalactosyl-diglyceride | C45 H86 O10 | 13 |
| LHG | 1,2-dipalmitoyl-phosphatidyl-glycerole | C38 H75 O10 P | 10 |
| SQD | 1,2-di-O-acyl-3-O-[6-deoxy-6-sulfo-alpha-D-glucopyranosyl]-sn-glycerol | C41 H78 O12 S | 8 |
| DGD | Digalactosyl diacyl glycerol (DGDG) | C51 H96 O15 | 9 |
| OEX | Ca-MN4-O5 cluster | Ca Mn4 O5 | 2 |
| OEY | Ca-MN4-O6 cluster | Ca Mn4 O6 | 2 |
| STE | Stearic acid | C18 H36 O2 | 35 |
| BCT | Bicarbonate ion | C H O3 | 2 |
| HEC | Heme C | C34 H36 Fe N4 O4 | 4 |
Water and common crystallization additives (CL) are not listed.
Primary citation
Untangling the sequence of events during the S2→ S3transition in photosystem II and implications for the water oxidation mechanism. Ibrahim, M., Fransson, T., Chatterjee, R. et al. Proc Natl Acad Sci U S A (2020) 117:12624-12635. DOI 10.1073/pnas.2000529117 · PubMed
Other PDB entries of the same protein (UniProt P0A444 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 5OJ5 1.08 Å, YCF48 bound to D1 peptide
- 9EVX 1.71 Å, cryoEM structure of Photosystem II averaged across S2-S3 states at 1.71 Angstrom…
- 7RF1 1.89 Å, RT XFEL structure of Photosystem II averaged across all S-states at 1.89 Angstrom…
- 9Z35 1.93 Å, RT XFEL structure of two-flash state of Photosystem II (2F, S3 rich) at 1.93 Angstrom…
- 9Z6A 1.93 Å, RT XFEL structure of the two-flash state of Photosystem II (2F, S3 rich) at 1.93…
- 9Z33 1.97 Å, RT XFEL structure of dark-stable state of Photosystem II (0F, S1 rich) at 1.97 Angstrom…
- 9Z68 1.97 Å, RT XFEL structure of the dark-stable state of Photosystem II (0F, S1 rich) at 1.97…
- 9Z34 1.98 Å, RT XFEL structure of one-flash state of Photosystem II (1F, S2 rich) at 1.98 Angstrom…
- 9Z69 1.98 Å, RT XFEL structure of the one-flash state of Photosystem II (1F, S2 rich) at 1.98…
- 8F4C 2.0 Å, RT XFEL structure of the two-flash state of Photosystem II (2F, S3-rich) at 2.00…
- 8F4I 2.0 Å, RT XFEL structure of Photosystem II 2000 microseconds after the third illumination at…
- 8F4J 2.0 Å, RT XFEL structure of Photosystem II 4000 microseconds after the third illumination at…
Browse structure collections
About this viewer
MolViewer shows 6W1T directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.