6W4L: Histone H2B 1.1,Histone H2A type 1

The crystal structure of a single chain H2B-H2A histone chimera from Xenopus laevis. Determined by X-ray diffraction at 1.31 Å resolution. Released 6 May 2020.

Method: X-ray diffraction
Resolution: 1.31 Å
Organism: Xenopus laevis
Chains: 1
Atoms: 1,434
Mol. weight: 20.7 kDa
Ligands: PPV
Released: 6 May 2020

Explore 6W4L in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6W4L contains 9 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	39-49	11
β-strand	54-55	2	1
α-helix	57-84	28
β-strand	89-90	2	2
α-helix	92-102	11
α-helix	105-124	20
α-helix	1018-1021	4
α-helix	1028-1037	10
β-strand	1043-1044	2	2
α-helix	1047-1073	27
β-strand	1078-1079	2	1
α-helix	1081-1089	9
α-helix	1092-1097	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Histone H2B 1.1,Histone H2A type 1	A	protein	186	Xenopus laevis	P02281 (AlphaFold model), P06897 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6W4L_1 Histone H2B 1.1,Histone H2A type 1 (chains A)
GRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITS
REIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAKKAKTRSSRAGLQFPVGRVHRLLRKGN
YAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLG
GVTIAQ

Ligands and cofactors

ID	Name	Formula	Copies
PPV	Pyrophosphate	H4 O7 P2	1

Primary citation

Structure of a single-chain H2A/H2B dimer. Warren, C., Bonanno, J.B., Almo, S.C. et al. Acta Crystallogr F Struct Biol Commun (2020) 76:194-198. DOI 10.1107/S2053230X20004604 · PubMed

Other PDB entries of the same protein (UniProt P02281 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8ZVY 1.72 Å, Alpha-Synuclein with H2a-H2b dimer complex structure.
1KX5 1.94 Å, X-Ray Structure of the Nucleosome Core Particle, NCP147, at 1.9 A Resolution
1KX3 2.0 Å, X-Ray Structure of the Nucleosome Core Particle, NCP146, at 2.0 A Resolution
1S32 2.05 Å, Molecular Recognition of the Nucleosomal 'Supergroove'
3UTA 2.07 Å, Crystal Structure of Nucleosome Core Particle Assembled with an Alpha-Satellite Sequence…
3UT9 2.2 Å, Crystal Structure of Nucleosome Core Particle Assembled with a Palindromic Widom '601'…
3UTB 2.2 Å, Crystal Structure of Nucleosome Core Particle Assembled with the 146b Alpha-Satellite…
6WZ5 2.2 Å, Bridging of double-strand DNA break activates PARP2/HPF1 to modify chromatin
8RUQ 2.29 Å, Borealin N-terminus in complex with H3.T3p-nucleosome
1M19 2.3 Å, Ligand binding alters the structure and dynamics of nucleosomal DNA
1P3I 2.3 Å, Crystallographic Studies of Nucleosome Core Particles containing Histone 'Sin' Mutants
3MGR 2.3 Å, Binding of Rubidium ions to the Nucleosome Core Particle

Browse structure collections

About this viewer

MolViewer shows 6W4L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.