6WG0: Fab366

Crystal structure of Fab366 in complex with NPNA3 peptide from circumsporozoite protein. Determined by X-ray diffraction at 1.6 Å resolution. Released 29 Jul 2020.

Method: X-ray diffraction
Resolution: 1.6 Å
Organisms: Homo sapiens, Plasmodium falciparum
Chains: 3
Atoms: 3,669
Mol. weight: 48.41 kDa
Released: 29 Jul 2020

Explore 6WG0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6WG0 contains 18 α-helices and 44 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 10 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	1
β-strand	10-12	3	2
β-strand	18-25	8	1
α-helix	29-31	3
β-strand	34-39	6	2
β-strand	45-51	7	2
β-strand	57-59	3	2
α-helix	61-63	3
β-strand	67-72	6	1
α-helix	73-75	3
β-strand	77-82	6	1
α-helix	84-86	3
β-strand	88-96	9	2
β-strand	100C-103	5	2
β-strand	107-111	5	2
β-strand	116	1	3
α-helix	117-118	2
β-strand	119-123	5	4
α-helix	127-129	3
β-strand	130-131	2	4
β-strand	134-144	11	4
β-strand	145	1	3
β-strand	150-153	4	5
α-helix	154-156	3
β-strand	158	1	5
β-strand	162-164	3	4
α-helix	165-167	3
β-strand	168-169	2	4
β-strand	175-184	10	4
α-helix	185-189	5
β-strand	194-199	6	5
α-helix	200-202	3
β-strand	204-209	6	5

Chain L: 8 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	6
β-strand	10-13	4	7
β-strand	19-25	7	6
β-strand	33-38	6	7
β-strand	45-49	5	7
β-strand	53-54	2	7
α-helix	55	1
β-strand	62-67	6	6
β-strand	70-75	6	6
α-helix	80-82	3
β-strand	84-90	7	7
β-strand	97-98	2	7
β-strand	102-106	5	7
β-strand	111	1	8
α-helix	112-113	2
β-strand	114-118	5	9
α-helix	119-121	3
α-helix	122-125	4
β-strand	129-139	11	9
β-strand	140	1	8
β-strand	145-150	6	10
β-strand	153-154	2	10
α-helix	155	1
β-strand	159-163	5	9
α-helix	164-167	4
β-strand	173-182	10	9
α-helix	183-186	4
β-strand	191-197	7	10
β-strand	205-210	6	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fab366 heavy chain	H	protein	223	Homo sapiens
Fab366 light chain	L	protein	213	Homo sapiens
NPNA3 peptide	P	protein	11	Plasmodium falciparum	P02893 (AlphaFold model)

Sequence of entity 1 (H), FASTA

>6WG0_1 Fab366 heavy chain (chains H)
QVQLVQSGAEVKKPGASARVSCKASGYTLTDFYLHWVRQAPGQGLEWMGWLNPHSGGTNY
AQKFLGRVSMTRDTSISTAYMELNKLISDDTAVYFCVRSDQEALRGAFDIWGQGTMVFVV
SRRLPPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS
GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC

Sequence of entity 2 (L), FASTA

>6WG0_2 Fab366 light chain (chains L)
DIQMTQSPSSLSASVGDTVTITCRASQSINDYLNWYQQKPGKAPKLLIYATSSLHSGVPS
RFSGSGFGTDFTLTISSLQPEDSATYLCQQSHSLWTFGQGTKVEVKRTVAAPSVFIFPPS
DEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTL
SKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 3 (P), FASTA

>6WG0_3 NPNA3 peptide (chains P)
NPNANPNANPN

Primary citation

Structural and biophysical correlation of anti-NANP antibodies with in vivo protection against P. falciparum. Pholcharee, T., Oyen, D., Flores-Garcia, Y. et al. Nat Commun (2021) 12:1063-1063. DOI 10.1038/s41467-021-21221-4 · PubMed

Other PDB entries of the same protein (UniProt P02893 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6WFY 1.23 Å, Crystal structure of Fab224 in complex with NPNA4 peptide from circumsporozoite protein
6AZM 1.6 Å, Crystal structure of the 580 germline antibody bound to circumsporozoite protein NANP…
6UC5 1.75 Å, Fab397 in complex with NPNA peptide
7RD4 1.75 Å, Crystal structure of PfCSP peptide 21 with vaccine-elicited human anti-malaria antibody…
6B5R 1.77 Å, Structure of PfCSP peptide 21 with human antibody CIS42
6B5M 1.79 Å, Structure of PfCSP peptide 21 with human protective antibody CIS43
7RD3 1.81 Å, Crystal structure of PfCSP peptide 21 with vaccine-elicited human anti-malaria antibody…
6WFZ 1.84 Å, Crystal structure of Fab399 in complex with NPNA3 peptide from circumsporozoite protein
6D0X 1.85 Å, Crystal structure of chimeric H.2140 / K.1210 Fab in complex with circumsporozoite…
6UUD 1.85 Å, Crystal structure of antibody 5D5 in complex with PfCSP N-terminal peptide
6W00 1.85 Å, Crystal structure of Fab239 in complex with NPNA2 peptide from circumsporozoite protein
7RD9 1.91 Å, Crystal structure of PfCSP peptide 21 with vaccine-elicited human anti-malaria antibody…

Browse structure collections

About this viewer

MolViewer shows 6WG0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.