Cryo-EM structure of SARS-CoV-2 ORF3a. Determined by electron microscopy at 2.9 Å resolution. Released 17 Jun 2020.
Explore 6XDC in 3D Show helices and sheets RCSB PDB PDBe
6XDC contains 10 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 44-60 | 17 | |
| α-helix | 68-99 | 32 | |
| α-helix | 103-133 | 31 | |
| α-helix | 137-140 | 4 | |
| β-strand | 145-148 | 4 | 1 |
| β-strand | 150 | 1 | 2 |
| β-strand | 155 | 1 | 2 |
| β-strand | 158-160 | 3 | 1 |
| β-strand | 166-172 | 7 | 1 |
| β-strand | 183-186 | 4 | 1 |
| β-strand | 189-192 | 4 | 1 |
| β-strand | 200-204 | 5 | 1 |
| β-strand | 209-218 | 10 | 1 |
| α-helix | 220-223 | 4 | |
| β-strand | 228-235 | 8 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 44-60 | 17 | |
| α-helix | 68-99 | 32 | |
| α-helix | 103-132 | 30 | |
| α-helix | 137-140 | 4 | |
| β-strand | 145-148 | 4 | 3 |
| β-strand | 150 | 1 | 4 |
| β-strand | 155 | 1 | 4 |
| β-strand | 158-160 | 3 | 3 |
| β-strand | 166-172 | 7 | 3 |
| β-strand | 183-186 | 4 | 3 |
| β-strand | 189-192 | 4 | 3 |
| β-strand | 200-204 | 5 | 3 |
| β-strand | 209-218 | 10 | 3 |
| α-helix | 220-223 | 4 | |
| β-strand | 228-235 | 8 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| ORF3a protein | A, B | protein | 284 | Severe acute respiratory syndrome coronavirus 2 | P0DTC3 (AlphaFold model) |
>6XDC_1 ORF3a protein (chains A, B) MDLFMRIFTIGTVTLKQGEIKDATPSDFVRATATIPIQASLPFGWLIVGVALLAVFQSAS KIITLKKRWQLALSKGVHFVCNLLLLFVTVYSHLLLVAAGLEAPFLYLYALVYFLQSINF VRIIMRLWLCWKCRSKNPLLYDANYFLCWHTNCYDYCIPYNSVTSSIVITSGDGTTSPIS EHDYQIGGYTEKWESGVKDCVVLHSYFTSDYYQLYSTQLSTDTGVEHVTFFIYNKIVDEP EEHVQIHTIDGSSGVVNPVMEPIYDEPTTTTSVPLSNSLEVLFQ
Cryo-EM structure of SARS-CoV-2 ORF3a in lipid nanodiscs. Kern, D.M., Sorum, B., Mali, S.S. et al. Nat Struct Mol Biol (2021) 28:573-582. DOI 10.1038/s41594-021-00619-0 · PubMed
Other PDB entries of the same protein (UniProt P0DTC3 (AlphaFold model), which also has an AlphaFold model), best resolution first:
6XDC is part of these collections:
MolViewer shows 6XDC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.