6XKB: SR-related and CTD-associated factor 4
Crystal structure of SR-related and CTD-associated factor 4(SCAF4-CID)with peptide S2,S5p-CTD. Determined by X-ray diffraction at 1.6 Å resolution. Released 20 Jan 2021.
- Method
- X-ray diffraction
- Resolution
- 1.6 Å
- Organism
- Homo sapiens
- Chains
- 10
- Atoms
- 6,715
- Mol. weight
- 92.73 kDa
- Released
- 20 Jan 2021
Explore 6XKB in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
6XKB contains 85 α-helices and 10 β-strands across 10 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 14 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| α-helix | 1-12 | 12 | |
| α-helix | 13-16 | 4 | |
| α-helix | 18 | 1 | |
| α-helix | 21 | 1 | |
| β-strand | 22 | 1 | 1 |
| α-helix | 23-35 | 13 | |
| α-helix | 37-39 | 3 | |
| α-helix | 40-53 | 14 | |
| α-helix | 56-58 | 3 | |
| α-helix | 59-77 | 19 | |
| α-helix | 84-89 | 6 | |
| α-helix | 92-99 | 8 | |
| α-helix | 104-106 | 3 | |
| α-helix | 107-120 | 14 | |
| α-helix | 125-134 | 10 | |
Chain B: 14 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| α-helix | 1-12 | 12 | |
| α-helix | 13-16 | 4 | |
| α-helix | 18 | 1 | |
| α-helix | 21 | 1 | |
| β-strand | 22 | 1 | 2 |
| α-helix | 23-35 | 13 | |
| α-helix | 37-39 | 3 | |
| α-helix | 40-53 | 14 | |
| α-helix | 56-58 | 3 | |
| α-helix | 59-77 | 19 | |
| α-helix | 84-90 | 7 | |
| α-helix | 92-99 | 8 | |
| α-helix | 104-106 | 3 | |
| α-helix | 107-120 | 14 | |
| α-helix | 125-133 | 9 | |
Chain C: 14 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| α-helix | 1-12 | 12 | |
| α-helix | 13-16 | 4 | |
| α-helix | 18 | 1 | |
| α-helix | 21 | 1 | |
| β-strand | 22 | 1 | 3 |
| α-helix | 23-35 | 13 | |
| α-helix | 37-39 | 3 | |
| α-helix | 40-53 | 14 | |
| α-helix | 56-58 | 3 | |
| α-helix | 59-77 | 19 | |
| α-helix | 84-89 | 6 | |
| α-helix | 92-99 | 8 | |
| α-helix | 104-106 | 3 | |
| α-helix | 107-119 | 13 | |
| α-helix | 125-133 | 9 | |
Chain D: 14 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| α-helix | 2-12 | 11 | |
| α-helix | 13-16 | 4 | |
| α-helix | 18 | 1 | |
| α-helix | 21 | 1 | |
| β-strand | 22 | 1 | 4 |
| α-helix | 23-35 | 13 | |
| α-helix | 37-39 | 3 | |
| α-helix | 40-53 | 14 | |
| α-helix | 56-58 | 3 | |
| α-helix | 59-77 | 19 | |
| α-helix | 84-89 | 6 | |
| α-helix | 92-99 | 8 | |
| α-helix | 104-106 | 3 | |
| α-helix | 107-119 | 13 | |
| α-helix | 125-134 | 10 | |
Chain E: 14 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| α-helix | 1-12 | 12 | |
| α-helix | 13-16 | 4 | |
| α-helix | 18 | 1 | |
| α-helix | 21 | 1 | |
| β-strand | 22 | 1 | 5 |
| α-helix | 23-35 | 13 | |
| α-helix | 37-39 | 3 | |
| α-helix | 40-53 | 14 | |
| α-helix | 56-58 | 3 | |
| α-helix | 59-77 | 19 | |
| α-helix | 84-89 | 6 | |
| α-helix | 92-99 | 8 | |
| α-helix | 104-106 | 3 | |
| α-helix | 107-119 | 13 | |
| α-helix | 125-135 | 11 | |
Chains F and I: 3 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| α-helix | 2 | 1 | |
| β-strand | 3 | 1 | 2 |
| α-helix | 4 | 1 | |
| α-helix | 9-13 | 5 | |
Chain G: 3 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| α-helix | 2 | 1 | |
| β-strand | 3 | 1 | 1 |
| α-helix | 4 | 1 | |
| α-helix | 9-12 | 4 | |
Chains J and K: 3 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| α-helix | 2 | 1 | |
| β-strand | 3 | 1 | 4 |
| α-helix | 4 | 1 | |
| α-helix | 10-13 | 4 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| SR-related and CTD-associated factor 4 | A, B, C, D, E | protein | 140 | Homo sapiens | O95104 (AlphaFold model) |
| S2,S5p-CTD peptide | F, G, I, J, K | protein | 20 | Homo sapiens | P24928 (AlphaFold model) |
Sequence of entity 1 (A, B, C, D, E), FASTA
>6XKB_1 SR-related and CTD-associated factor 4 (chains A, B, C, D, E)
GMDAVNAFNQELFSLMDMKPPISRAKMILITKAAIKAIKLYKHVVQIVEKFIKKCKPEYK
VPGLYVIDSIVRQSRHQFGTDKDVFGPRFSKNITATFQYLYLCPSEDKSKIVRVLNLWQK
NGVFKIEIIQPLLDMAAGTS
Sequence of entity 2 (F, G, I, J, K), FASTA
>6XKB_2 S2,S5p-CTD peptide (chains F, G, I, J, K)
XSPSYSPTSPSYSPTSPSYS
Primary citation
Structural basis for the recognition of the S2, S5-phosphorylated RNA polymerase II CTD by the mRNA anti-terminator protein hSCAF4. Zhou, M., Ehsan, F., Gan, L. et al. FEBS Lett (2022) 596:249-259. DOI 10.1002/1873-3468.14256 · PubMed
Browse structure collections
About this viewer
MolViewer shows 6XKB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.