6XLL: DNA-directed RNA polymerase subunit alpha

Cryo-EM structure of E. coli RNAP-promoter initial transcribing complex with 5-nt RNA transcript (RPitc-5nt). Determined by electron microscopy at 2.7 Å resolution. Released 7 Apr 2021.

Method: Electron microscopy
Resolution: 2.7 Å
Organism: Escherichia coli O157:H7
Chains: 9
Atoms: 31,134
Mol. weight: 496.35 kDa
Ligands: 1N7, ZN, MG
Released: 7 Apr 2021

Explore 6XLL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6XLL contains 177 α-helices and 234 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	9-11	3
β-strand	12-20	9	1
β-strand	23-31	9	1
α-helix	35-50	16
β-strand	52-61	10	2
β-strand	70	1	3
β-strand	74	1	4
β-strand	77	1	3
α-helix	78-85	8
β-strand	90-92	3	5
β-strand	97-105	9	2
β-strand	108-111	4	4
α-helix	112-114	3
β-strand	115	1	2
α-helix	116-118	3
β-strand	121-123	3	5
β-strand	129-133	5	4
β-strand	139-150	12	2
β-strand	152-153	2	6
α-helix	155-157	3
α-helix	166-167	2
β-strand	171-172	2	2
β-strand	175-176	2	6
β-strand	180-189	10	1
β-strand	199-207	9	1
α-helix	213-227	15
α-helix	229-233	5

Chain B: 5 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	13-14	2	7
β-strand	17-20	4	7
β-strand	23-31	9	7
α-helix	32	1
α-helix	35-49	15
β-strand	52-61	10	8
β-strand	74	1	9
α-helix	78-86	9
β-strand	89	1	8
β-strand	90-92	3	10
β-strand	97-105	9	8
β-strand	108-110	3	9
α-helix	112-114	3
β-strand	115	1	8
β-strand	121-123	3	10
β-strand	131-133	3	9
β-strand	139-150	12	8
β-strand	152-153	2	11
β-strand	171-172	2	8
β-strand	175-176	2	11
β-strand	180-192	13	7
β-strand	195-207	13	7
α-helix	213-228	16

Chain C: 61 helices, 102 β-strands

Element	Residues	Length	Sheet
α-helix	11-12	2
β-strand	13-14	2	12
α-helix	19-20	2
α-helix	29-39	11
α-helix	48-56	9
β-strand	59-60	2	13
β-strand	66-75	10	13
α-helix	82-87	6
β-strand	93-105	13	13
β-strand	114-128	15	13
α-helix	129	1
β-strand	130	1	14
α-helix	131	1
β-strand	136-138	3	14
β-strand	141-145	5	14
β-strand	147-151	5	15
α-helix	152	1
β-strand	154-160	7	16
β-strand	171-177	7	16
β-strand	180	1	17
β-strand	184-188	5	16
β-strand	194-198	5	16
α-helix	203	1
β-strand	204-205	2	16
α-helix	207-212	6
α-helix	217-224	8
β-strand	227-231	5	18
β-strand	238-240	3	19
α-helix	243-246	4
β-strand	250-251	2	20
β-strand	256	1	19
β-strand	261	1	19
β-strand	267-268	2	20
α-helix	271-279	9
β-strand	284-286	3	19
α-helix	289-292	4
α-helix	295	1
β-strand	296	1	21
β-strand	297	1	18
β-strand	301-303	3	22
β-strand	308-311	4	22
β-strand	316	1	21
α-helix	319-325	7
α-helix	326-328	3
β-strand	332-336	5	18
α-helix	346-351	6
α-helix	359-370	12
α-helix	378-389	12
β-strand	396	1	17
α-helix	399-408	10
α-helix	422-436	15
β-strand	451-454	4	15
α-helix	456-478	23
α-helix	489-491	3
α-helix	495-508	14
β-strand	512-514	3	14
α-helix	520-526	7
β-strand	529-531	3	15
β-strand	533	1	23
β-strand	538	1	23
α-helix	552-554	3
β-strand	558	1	24
β-strand	572-574	3	15
β-strand	575	1	24
β-strand	576	1	25
β-strand	580-581	2	26
β-strand	587-594	8	26
β-strand	599-607	9	26
β-strand	616-617	2	26
β-strand	623	1	27
β-strand	629	1	27
β-strand	633-637	5	26
β-strand	642-646	5	26
β-strand	652-654	3	26
β-strand	662	1	25
α-helix	665-667	3
α-helix	671-673	3
β-strand	674	1	28
α-helix	676-686	11
β-strand	689	1	29
α-helix	690-691	2
β-strand	696	1	30
β-strand	700-701	2	12
α-helix	705-711	7
β-strand	716-717	2	31
β-strand	722-728	7	32
β-strand	731-736	6	32
α-helix	741-742	2
β-strand	748-752	5	32
α-helix	753-754	2
β-strand	757-758	2	33
β-strand	763	1	34
β-strand	764-765	2	33
β-strand	769	1	31
α-helix	772	1
β-strand	776-777	2	32
β-strand	782-784	3	31
β-strand	789-790	2	35
β-strand	793-794	2	35
β-strand	797	1	30
β-strand	798-804	7	36
β-strand	815-819	5	36
α-helix	820-824	5
β-strand	830-841	12	34
β-strand	842-843	2	37
β-strand	846-847	2	37
β-strand	849-850	2	38
α-helix	861-863	3
β-strand	865	1	39
β-strand	870	1	40
β-strand	871	1	39
α-helix	872	1
β-strand	876-877	2	34
β-strand	882-884	3	40
β-strand	886-889	4	38
α-helix	897-906	10
α-helix	909-911	3
β-strand	913-915	3	38
β-strand	918-919	2	40
α-helix	920-921	2
β-strand	926-935	10	34
β-strand	936	1	41
α-helix	940-941	2
α-helix	943-979	37
α-helix	986-989	4
α-helix	994-996	3
α-helix	1001-1003	3
α-helix	1007-1036	30
β-strand	1040	1	41
α-helix	1042-1043	2
β-strand	1046-1058	13	34
β-strand	1065-1067	3	36
β-strand	1074-1080	7	36
α-helix	1082-1084	3
β-strand	1087	1	42
β-strand	1093	1	42
β-strand	1096-1098	3	36
α-helix	1100-1102	3
β-strand	1108	1	28
α-helix	1110-1133	24
α-helix	1138-1150	13
α-helix	1166-1175	10
β-strand	1182-1183	2	12
α-helix	1192-1201	10
β-strand	1209-1210	2	36
β-strand	1213	1	42
α-helix	1219	1
β-strand	1220	1	42
α-helix	1221	1
β-strand	1225-1234	10	36
β-strand	1235	1	29
β-strand	1244-1246	3	43
β-strand	1251	1	44
β-strand	1252	1	45
β-strand	1258	1	44
β-strand	1268-1270	3	46
α-helix	1272-1280	9
α-helix	1284-1291	8
α-helix	1292-1296	5
α-helix	1298-1309	12
α-helix	1321-1330	10
β-strand	1335-1337	3	47
β-strand	1340	1	48

Chain D: 69 helices, 90 β-strands

Element	Residues	Length	Sheet
β-strand	19	1	48
β-strand	20-21	2	49
β-strand	22-24	3	47
α-helix	27-33	7
β-strand	37	1	50
β-strand	44	1	51
α-helix	50	1
β-strand	51	1	51
α-helix	52	1
α-helix	59-62	4
β-strand	66	1	52
β-strand	69	1	52
α-helix	78-80	3
β-strand	84	1	53
β-strand	91	1	53
α-helix	95-99	5
β-strand	103-112	10	50
α-helix	115-118	4
α-helix	122	1
α-helix	123-128	6
α-helix	132-138	7
β-strand	144-148	5	54
β-strand	159-160	2	54
α-helix	162-172	11
β-strand	177-179	3	54
α-helix	182-191	10
α-helix	194-206	13
α-helix	211-229	19
α-helix	234-237	4
β-strand	238-244	7	50
β-strand	253-254	2	55
β-strand	260-262	3	55
α-helix	264-285	22
α-helix	289-307	19
α-helix	315-316	2
β-strand	317	1	56
β-strand	323	1	56
α-helix	327-331	5
α-helix	337	1
α-helix	338-342	5
β-strand	345-347	3	46
β-strand	350-354	5	43
β-strand	355-356	2	57
β-strand	365-369	5	57
α-helix	370-376	7
α-helix	378-387	10
α-helix	394-403	10
α-helix	406-415	10
β-strand	421-424	4	43
α-helix	431-433	3
β-strand	434-437	4	43
β-strand	438-442	5	57
β-strand	447-448	2	57
α-helix	451-453	3
α-helix	454-457	4
β-strand	465-469	5	43
α-helix	474-479	6
α-helix	480-484	5
β-strand	485	1	43
β-strand	491	1	58
β-strand	498	1	58
α-helix	504-513	10
β-strand	517	1	59
β-strand	526-527	2	60
α-helix	530-538	9
β-strand	546	1	59
β-strand	547-557	11	60
β-strand	563-573	11	60
α-helix	574-579	6
α-helix	580-582	3
α-helix	589-591	3
α-helix	598-611	14
α-helix	614-633	20
α-helix	645-647	3
α-helix	650-669	20
α-helix	675-702	28
β-strand	706-709	4	61
β-strand	712-715	4	61
α-helix	721-728	8
α-helix	734-741	8
β-strand	745	1	62
β-strand	748	1	63
α-helix	753	1
β-strand	754	1	63
α-helix	755	1
β-strand	759	1	62
α-helix	769-804	36
β-strand	809-811	3	64
β-strand	820-822	3	65
β-strand	825-827	3	66
β-strand	828	1	67
β-strand	830-833	4	66
α-helix	836-839	4
β-strand	843	1	68
β-strand	844	1	65
β-strand	848-849	2	69
β-strand	856-858	3	69
β-strand	863	1	68
α-helix	866-874	9
β-strand	880-882	3	65
α-helix	885-887	3
β-strand	894-895	2	64
α-helix	896-899	4
β-strand	901	1	70
β-strand	908	1	70
α-helix	909-910	2
α-helix	915-924	10
α-helix	926-929	4
β-strand	949-951	3	71
β-strand	957-961	5	67
β-strand	965-967	3	71
β-strand	973-975	3	71
β-strand	981-985	5	67
β-strand	991-996	6	67
β-strand	1002-1003	2	71
β-strand	1010	1	67
β-strand	1016-1019	4	71
β-strand	1024-1028	5	72
β-strand	1033-1038	6	73
β-strand	1042	1	74
β-strand	1046-1049	4	74
β-strand	1058-1061	4	74
α-helix	1062-1063	2
β-strand	1077-1081	5	73
α-helix	1096-1097	2
β-strand	1099-1100	2	73
α-helix	1101-1102	2
β-strand	1106	1	72
β-strand	1107	1	74
β-strand	1114-1115	2	73
β-strand	1120-1125	6	72
α-helix	1138-1145	8
β-strand	1156	1	75
β-strand	1162-1165	4	76
β-strand	1172	1	77
β-strand	1175-1178	4	76
β-strand	1187-1188	2	76
β-strand	1191	1	77
β-strand	1196	1	78
β-strand	1203	1	76
β-strand	1209	1	75
β-strand	1211	1	78
α-helix	1215-1216	2
α-helix	1217-1219	3
α-helix	1220-1224	5
α-helix	1226-1243	18
α-helix	1251-1260	10
β-strand	1263-1268	6	79
β-strand	1279-1281	3	79
α-helix	1282-1293	12
β-strand	1301-1305	5	79
α-helix	1309-1313	5
α-helix	1319-1325	7
α-helix	1328-1338	11
β-strand	1341-1342	2	49
α-helix	1348-1352	5
α-helix	1355-1357	3
α-helix	1360-1362	3
α-helix	1363-1372	10

Chain E: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	7-12	6
α-helix	17-31	15
α-helix	46-55	10
α-helix	61-76	16

Chain F: 29 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	97-106	10
α-helix	113-135	23
α-helix	138-152	15
β-strand	165	1	80
α-helix	214-232	19
α-helix	248-256	9
β-strand	259	1	80
α-helix	263-291	29
α-helix	300-306	7
α-helix	314-316	3
α-helix	320-322	3
α-helix	326-329	4
α-helix	330-333	4
α-helix	338-350	13
α-helix	355-382	28
α-helix	384-391	8
α-helix	392-394	3
α-helix	401-417	17
α-helix	421-423	3
α-helix	427-446	20
α-helix	454-474	21
α-helix	477-479	3
α-helix	480-486	7
α-helix	491-500	10
α-helix	502-504	3
β-strand	505-506	2	55
α-helix	509-510	2
β-strand	511	1	81
β-strand	514	1	81
β-strand	524	1	45
α-helix	531-549	19
α-helix	553-562	10
α-helix	573-580	8
α-helix	584-598	15
α-helix	605-608	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA-directed RNA polymerase subunit alpha	A, B	protein	329	Escherichia coli O157:H7	P0A7Z4 (AlphaFold model)
DNA-directed RNA polymerase subunit beta	C	protein	1342	Escherichia coli O157:H7	P0A8V2 (AlphaFold model)
DNA-directed RNA polymerase subunit beta'	D	protein	1407	Escherichia coli O157:H7	P0A8T7 (AlphaFold model)
DNA-directed RNA polymerase subunit omega	E	protein	91	Escherichia coli O157:H7	P0A800 (AlphaFold model)
RNA polymerase sigma factor RpoD	F	protein	613	Escherichia coli O157:H7	P00579
synthetic non-template strand DNA (54-MER)	N	DNA	54	Escherichia coli O157:H7
synthetic template strand DNA (54-MER)	T	DNA	54	Escherichia coli O157:H7
RNA transcript (5-MER)	R	RNA	5	Escherichia coli O157:H7

Sequence of entity 1 (A, B), FASTA

>6XLL_1 DNA-directed RNA polymerase subunit alpha (chains A, B)
MQGSVTEFLKPRLVDIEQVSSTHAKVTLEPLERGFGHTLGNALRRILLSSMPGCAVTEVE
IDGVLHEYSTKEGVQEDILEILLNLKGLAVRVQGKDEVILTLNKSGIGPVTAADITHDGD
VEIVKPQHVICHLTDENASISMRIKVQRGRGYVPASTRIHSEEDERPIGRLLVDACYSPV
ERIAYNVEAARVEQRTDLDKLVIEMETNGTIDPEEAIRRAATILAEQLEAFVDLRDVRQP
EVKEEKPEFDPILLRPVDDLELTVRSANCLKAEAIHYIGDLVQRTEVELLKTPNLGKKSL
TEIKDVLASRGLSLGMRLENWPPASIADE

Sequence of entity 2 (C), FASTA

>6XLL_2 DNA-directed RNA polymerase subunit beta (chains C)
MVYSYTEKKRIRKDFGKRPQVLDVPYLLSIQLDSFQKFIEQDPEGQYGLEAAFRSVFPIQ
SYSGNSELQYVSYRLGEPVFDVQECQIRGVTYSAPLRVKLRLVIYEREAPEGTVKDIKEQ
EVYMGEIPLMTDNGTFVINGTERVIVSQLHRSPGVFFDSDKGKTHSSGKVLYNARIIPYR
GSWLDFEFDPKDNLFVRIDRRRKLPATIILRALNYTTEQILDLFFEKVIFEIRDNKLQME
LVPERLRGETASFDIEANGKVYVEKGRRITARHIRQLEKDDVKLIEVPVEYIAGKVVAKD
YIDESTGELICAANMELSLDLLAKLSQSGHKRIETLFTNDLDHGPYISETLRVDPTNDRL
SALVEIYRMMRPGEPPTREAAESLFENLFFSEDRYDLSAVGRMKFNRSLLREEIEGSGIL
SKDDIIDVMKKLIDIRNGKGEVDDIDHLGNRRIRSVGEMAENQFRVGLVRVERAVKERLS
LGDLDTLMPQDMINAKPISAAVKEFFGSSQLSQFMDQNNPLSEITHKRRISALGPGGLTR
ERAGFEVRDVHPTHYGRVCPIETPEGPNIGLINSLSVYAQTNEYGFLETPYRKVTDGVVT
DEIHYLSAIEEGNYVIAQANSNLDEEGHFVEDLVTCRSKGESSLFSRDQVDYMDVSTQQV
VSVGASLIPFLEHDDANRALMGANMQRQAVPTLRADKPLVGTGMERAVAVDSGVTAVAKR
GGVVQYVDASRIVIKVNEDEMYPGEAGIDIYNLTKYTRSNQNTCINQMPCVSLGEPVERG
DVLADGPSTDLGELALGQNMRVAFMPWNGYNFEDSILVSERVVQEDRFTTIHIQELACVS
RDTKLGPEEITADIPNVGEAALSKLDESGIVYIGAEVTGGDILVGKVTPKGETQLTPEEK
LLRAIFGEKASDVKDSSLRVPNGVSGTVIDVQVFTRDGVEKDKRALEIEEMQLKQAKKDL
SEELQILEAGLFSRIRAVLVAGGVEAEKLDKLPRDRWLELGLTDEEKQNQLEQLAEQYDE
LKHEFEKKLEAKRRKITQGDDLAPGVLKIVKVYLAVKRRIQPGDKMAGRHGNKGVISKIN
PIEDMPYDENGTPVDIVLNPLGVPSRMNIGQILETHLGMAAKGIGDKINAMLKQQQEVAK
LREFIQRAYDLGADVRQKVDLSTFSDEEVMRLAENLRKGMPIATPVFDGAKEAEIKELLK
LGDLPTSGQIRLYDGRTGEQFERPVTVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLG
GKAQFGGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVNGRTKMYKNIVDGNHQMEPGMP
ESFNVLLKEIRSLGINIELEDE

Sequence of entity 3 (D), FASTA

>6XLL_3 DNA-directed RNA polymerase subunit beta' (chains D)
MKDLLKFLKAQTKTEEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCAR
IFGPVKDYECLCGKYKRLKHRGVICEKCGVEVTQTKVRRERMGHIELASPTAHIWFLKSL
PSRIGLLLDMPLRDIERVLYFESYVVIEGGMTNLERQQILTEEQYLDALEEFGDEFDAKM
GAEAIQALLKSMDLEQECEQLREELNETNSETKRKKLTKRIKLLEAFVQSGNKPEWMILT
VLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKRLLDLAAPDIIVRNEKRMLQ
EAVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQNLLGKRVDYSGRSVITVGPY
LRLHQCGLPKKMALELFKPFIYGKLELRGLATTIKAAKKMVEREEAVVWDILDEVIREHP
VLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLEA
RALMMSTNNILSPANGEPIIVPSQDVVLGLYYMTRDCVNAKGEGMVLTGPKEAERLYRSG
LASLHARVKVRITEYEKDANGELVAKTSLKDTTVGRAILWMIVPKGLPYSIVNQALGKKA
ISKMLNTCYRILGLKPTVIFADQIMYTGFAYAARSGASVGIDDMVIPEKKHEIISEAEAE
VAEIQEQFQSGLVTAGERYNKVIDIWAAANDRVSKAMMDNLQTETVINRDGQEEKQVSFN
SIYMMADSGARGSAAQIRQLAGMRGLMAKPDGSIIETPITANFREGLNVLQYFISTHGAR
KGLADTALKTANSGYLTRRLVDVAQDLVVTEDDCGTHEGIMMTPVIEGGDVKEPLRDRVL
GRVTAEDVLKPGTADILVPRNTLLHEQWCDLLEENSVDAVKVRSVVSCDTDFGVCAHCYG
RDLARGHIINKGEAIGVIAAQSIGEPGTQLTMRTFHIGGAASRAAAESSIQVKNKGSIKL
SNVKSVVNSSGKLVITSRNTELKLIDEFGRTKESYKVPYGAVLAKGDGEQVAGGETVANW
DPHTMPVITEVSGFVRFTDMIDGQTITRQTDELTGLSSLVVLDSAERTAGGKDLRPALKI
VDAQGNDVLIPGTDMPAQYFLPGKAIVQLEDGVQISSGDTLARIPQESGGTKDITGGLPR
VADLFEARRPKEPAILAEISGIVSFGKETKGKRRLVITPVDGSDPYEEMIPKWRQLNVFE
GERVERGDVISDGPEAPHDILRLRGVHAVTRYIVNEVQDVYRLQGVKINDKHIEVIVRQM
LRKATIVNAGSSDFLEGEQVEYSRVKIANRELEANGKVGATYSRDLLGITKASLATESFI
SAASFQETTRVLTEAAVAGKRDELRGLKENVIVGRLIPAGTGYAYHQDRMRRRAAGEAPA
APQVTAEDASASLAELLNAGLGGSDNE

Sequence of entity 4 (E), FASTA

>6XLL_4 DNA-directed RNA polymerase subunit omega (chains E)
MARVTVQDAVEKIGNRFDLVLVAARRARQMQVGGKDPLVPEENDKTTVIALREIEEGLIN
NQILDVRERQEQQEQEAAELQAVTAIAEGRR

Sequence of entity 5 (F), FASTA

>6XLL_5 RNA polymerase sigma factor RpoD (chains F)
MEQNPQSQLKLLVTRGKEQGYLTYAEVNDHLPEDIVDSDQIEDIIQMINDMGIQVMEEAP
DADDLMLAENTADEDAAEAAAQVLSSVESEIGRTTDPVRMYMREMGTVELLTREGEIDIA
KRIEDGINQVQCSVAEYPEAITYLLEQYDRVEAEEARLSDLITGFVDPNAEEDLAPTATH
VGSELSQEDLDDDEDEDEEDGDDDSADDDNSIDPELAREKFAELRAQYVVTRDTIKAKGR
SHATAQEEILKLSEVFKQFRLVPKQFDYLVNSMRVMMDRVRTQERLIMKLCVEQCKMPKK
NFITLFTGNETSDTWFNAAIAMNKPWSEKLHDVSEEVHRALQKLQQIEEETGLTIEQVKD
INRRMSIGEAKARRAKKEMVEANLRLVISIAKKYTNRGLQFLDLIQEGNIGLMKAVDKFE
YRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIETINKLNRISRQMLQEMGREPTP
EELAERMLMPEDKIRKVLKIAKEPISMETPIGDDEDSHLGDFIEDTTLELPLDSATTESL
RAATHDVLAGLTAREAKVLRMRFGIDMNTDYTLEEVGKQFDVTRERIRQIEAKALRKLRH
PSRSEVLRSFLDD

Sequence of entity 6 (N), FASTA

>6XLL_6 synthetic non-template strand DNA (54-MER) (chains N)
GCCTTGACCCTCCCCTAAGGGGAGGGTTTAGATTGTGTGCAGTCTGACGCGGCG

Sequence of entity 7 (T), FASTA

>6XLL_7 synthetic template strand DNA (54-MER) (chains T)
CGCCGCGTCAGACTGCACACAATCTAAACCCTCCCCTTAGGGGAGGGTCAAGGC

Sequence of entity 8 (R), FASTA

>6XLL_8 RNA transcript (5-MER) (chains R)
GCAGU

Ligands and cofactors

ID	Name	Formula	Copies
1N7	Chapso	C32 H59 N2 O8 S	2
ZN	Zinc ion	Zn	2
MG	Magnesium ion	Mg	1

Primary citation

Structural visualization of transcription activated by a multidrug-sensing MerR family regulator. Yang, Y., Liu, C., Zhou, W. et al. Nat Commun (2021) 12:2702-2702. DOI 10.1038/s41467-021-22990-8 · PubMed

Other PDB entries of the same protein (UniProt P0A7Z4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3K4G 2.05 Å, Crystal structure of E. coli RNA polymerase alpha subunit C-terminal domain
8FVW 2.1 Å, CryoEM structure of E.coli transcription elongation complex bound to ppGpp
8FVR 2.42 Å, CryoEM structure of E.coli transcription elongation complex
9ZP4 2.42 Å, E. coli RNA polymerase elongation complex containing the unnatural dZ:PTP base pair in a…
8HKC 2.49 Å, Cryo-EM structure of E. coli RNAP sigma32 complex
1BDF 2.5 Å, Structure of escherichia coli RNA polymerase alpha subunit N-terminal domain
6XL5 2.5 Å, Cryo-EM structure of EcmrR-RNAP-promoter open complex (EcmrR-RPo)
6XL9 2.5 Å, Cryo-EM structure of EcmrR-RNAP-promoter initial transcribing complex with 3-nt RNA…
12EC 2.6 Å, Half-translocated RNA polymerase elemental paused elongation complex, swiveled (ePEC…
8F1J 2.6 Å, SigN RNA polymerase early-melted intermediate bound to mismatch DNA fragment dhsU36mm2…
8PIB 2.6 Å, autoinhibited RfaH bound to E. coli transcription complex paused at ops site (encounter…
9MSF 2.6 Å, de novo SigN RNA polymerase transcription initiation intermediate with post-catalytic…

Browse structure collections

About this viewer

MolViewer shows 6XLL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.