6XY4: Anti-apoptotic membrane protein

Name: PDB 6XY4: Structural insight into sheep-pox virus mediated inhibition of apoptosis
Published: 2020-07-29
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: apoptosis

Structural insight into sheep-pox virus mediated inhibition of apoptosis. Determined by X-ray diffraction at 2.05 Å resolution. Released 29 Jul 2020.

Method: X-ray diffraction
Resolution: 2.05 Å
Organisms: Sheeppox virus (strain Turkey/TU-V02127), Homo sapiens
Chains: 2
Atoms: 1,263
Mol. weight: 20.45 kDa
Released: 29 Jul 2020

Explore 6XY4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6XY4 contains 9 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	8-17	10
α-helix	21-23	3
α-helix	26-45	20
α-helix	47-57	11
α-helix	68-79	12
α-helix	85-106	22
α-helix	114-125	12
α-helix	127-135	9

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	29-49	21

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
anti-apoptotic membrane protein	A	protein	150	Sheeppox virus (strain Turkey/TU-V02127)	A0A3F2YKH3
Activator of apoptosis harakiri	B	protein	26	Homo sapiens	O00198 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6XY4_1 anti-apoptotic membrane protein (chains A)
GPLGSMDNCNYNIEKVLNVYLRDLRIESLNNNELEILIMIRECCEVIKKDYKTEFNEICN
FILQNNVKSCYDINDVKNIIIETINSDFRPSVILASISLLSIIIKKKKDENNEVVDDDLA
LNELINKFSSYQKDIISFVEKNKKKNKQND

Sequence of entity 2 (B), FASTA

>6XY4_2 Activator of apoptosis harakiri (chains B)
RSSAAQLTAARLKALGDELHQRTMWR

Primary citation

Crystal structures of the sheeppox virus encoded inhibitor of apoptosis SPPV14 bound to the proapoptotic BH3 peptides Hrk and Bax. Suraweera, C.D., Burton, D.R., Hinds, M.G. et al. FEBS Lett (2020) 594:2016-2026. DOI 10.1002/1873-3468.13807 · PubMed

Other PDB entries of the same protein (UniProt A0A3F2YKH3), best resolution first:

6XY6 2.91 Å, Structural insight into sheep-pox virus mediated inhibition of apoptosis

Browse structure collections

About this viewer

MolViewer shows 6XY4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.