6XY6: Anti-apoptotic membrane protein

Name: PDB 6XY6: Structural insight into sheep-pox virus mediated inhibition of apoptosis
Published: 2020-07-29
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: apoptosis

Structural insight into sheep-pox virus mediated inhibition of apoptosis. Determined by X-ray diffraction at 2.91 Å resolution. Released 29 Jul 2020.

Method: X-ray diffraction
Resolution: 2.91 Å
Organisms: Sheeppox virus (strain Turkey/TU-V02127), Homo sapiens
Chains: 16
Atoms: 10,320
Mol. weight: 162.56 kDa
Released: 29 Jul 2020

Explore 6XY6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6XY6 contains 72 α-helices and 0 β-strands across 16 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and K: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	8-17	10
α-helix	21-23	3
α-helix	26-45	20
α-helix	47-59	13
α-helix	68-81	14
α-helix	85-105	21
α-helix	113-125	13
α-helix	127-137	11

Chains B and N: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	54-73	20

Chain C: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	8-17	10
α-helix	21-23	3
α-helix	26-45	20
α-helix	47-59	13
α-helix	68-81	14
α-helix	85-105	21
α-helix	113-125	13
α-helix	127-141	15

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	53-73	21

Chains E, I, M and O: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	8-17	10
α-helix	21-23	3
α-helix	26-45	20
α-helix	47-59	13
α-helix	68-81	14
α-helix	85-105	21
α-helix	113-125	13
α-helix	127-136	10

Chains F, J and L: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	54-75	22

Chain G: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	8-17	10
α-helix	21-23	3
α-helix	26-45	20
α-helix	47-59	13
α-helix	68-81	14
α-helix	85-105	21
α-helix	113-125	13
α-helix	127-138	12

Chain H: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	55-76	22

1 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
anti-apoptotic membrane protein	A, G	protein	150	Sheeppox virus (strain Turkey/TU-V02127)	A0A3F2YKH3
Apoptosis regulator BAX	B, D, F, H, J, L, N, P	protein	28	Homo sapiens	Q07812 (AlphaFold model)
anti-apoptotic membrane protein	C, E, I, K, M, O	protein	145	Sheeppox virus (strain Turkey/TU-V02127)	A0A3F2YKH3

Sequence of entity 1 (A, G), FASTA

>6XY6_1 anti-apoptotic membrane protein (chains A, G)
GPLGSMDNCNYNIEKVLNVYLRDLRIESLNNNELEILIMIRECCEVIKKDYKTEFNEICN
FILQNNVKSCYDINDVKNIIIETINSDFRPSVILASISLLSIIIKKKKDENNEVVDDDLA
LNELINKFSSYQKDIISFVEKNKKKNKQND

Sequence of entity 2 (B, D, F, H, J, L, N, P), FASTA

>6XY6_2 Apoptosis regulator BAX (chains B, D, F, H, J, L, N, P)
VPQDASTKKLSECLKRIGDELDSNMELQ

Sequence of entity 3 (C, E, I, K, M, O), FASTA

>6XY6_3 anti-apoptotic membrane protein (chains C, E, I, K, M, O)
MDNCNYNIEKVLNVYLRDLRIESLNNNELEILIMIRECCEVIKKDYKTEFNEICNFILQN
NVKSCYDINDVKNIIIETINSDFRPSVILASISLLSIIIKKKKDENNEVVDDDLALNELI
NKFSSYQKDIISFVEKNKKKNKQND

Primary citation

Crystal structures of the sheeppox virus encoded inhibitor of apoptosis SPPV14 bound to the proapoptotic BH3 peptides Hrk and Bax. Suraweera, C.D., Burton, D.R., Hinds, M.G. et al. FEBS Lett (2020) 594:2016-2026. DOI 10.1002/1873-3468.13807 · PubMed

Other PDB entries of the same protein (UniProt A0A3F2YKH3), best resolution first:

6XY4 2.05 Å, Structural insight into sheep-pox virus mediated inhibition of apoptosis

Browse structure collections

About this viewer

MolViewer shows 6XY6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.