6YJG: MINDY1 mutant-Y114F

Crystal structure of MINDY1 mutant-Y114F. Determined by X-ray diffraction at 3.28 Å resolution. Released 14 Apr 2021.

Method: X-ray diffraction
Resolution: 3.28 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,984
Mol. weight: 32.02 kDa
Released: 14 Apr 2021

Explore 6YJG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6YJG contains 10 α-helices and 16 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	113-121	9	1
β-strand	124-130	7	1
α-helix	139-148	10
β-strand	160-162	3	1
α-helix	163-175	13
α-helix	177-179	3
α-helix	188-200	13
α-helix	201-203	3
β-strand	212	1	2
β-strand	213	1	3
β-strand	220	1	2
α-helix	226-231	6
β-strand	236-238	3	4
β-strand	239	1	5
α-helix	247-253	7
β-strand	257	1	3
α-helix	258-269	12
α-helix	275-289	15
β-strand	294	1	5
α-helix	296-305	10
β-strand	311-316	6	4
β-strand	319-326	8	4
β-strand	329-333	5	4
β-strand	347-349	3	4
β-strand	359-360	2	4
β-strand	366	1	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin carboxyl-terminal hydrolase MINDY1	A	protein	289	Homo sapiens	Q8N5J2 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6YJG_1 Ubiquitin carboxyl-terminal hydrolase MINDY1 (chains A)
GPLGSPEFPGRLEMEPDFFCVKWIPWKGEQTPIITQSTNGPCPLLAIMNILFLQWKVKLP
PQKEVITSDELMAHLGNCLLSIKPQEKSEGLQLNFQQNVDDAMTVLPKLATGLDVNVRFT
GVSDFEYTPECSVFDLLGIPLYHGWLVDPQSPEAVRAVGKLSYNQLVERIITCKHSSDTN
LVTEGLIAEQFLETTAAQLTYHGLCELTAAAKEGELSVFFRNNHFSTMTKHKSHLYLLVT
DQGFLQEEQVVWESLHNVDGDSCFCDSDFHLSHSLGKGPGAEGGSGSPE

Primary citation

Mechanism of activation and regulation of deubiquitinase activity in MINDY1 and MINDY2. Abdul Rehman, S.A., Armstrong, L.A., Lange, S.M. et al. Mol Cell (2021) 81:4176-4190.e6. DOI 10.1016/j.molcel.2021.08.024 · PubMed

Other PDB entries of the same protein (UniProt Q8N5J2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5MN9 2.05 Å, Crystal structure of MINDY-1 tMIU in complex with K48-diUb
6TUV 2.16 Å, Crystal structure of Mindy1 in complex with Lys48 linked di-ubiquitin
6TXB 2.18 Å, Crystal structure of Mindy1 mutant (P138A) in complex with Lys48 linked di-ubiquitin
5JQS 2.65 Å, Crystal structure of deubiquitinase MINDY-1 in complex with Ubiquitin
5JKN 3.0 Å, Crystal structure of deubiquitinase MINDY-1
6Y6R 3.32 Å, Crystal structure of MINDY1 T335D mutant
6Z90 3.59 Å, Crystal structure of MINDY1 mutant-P138A

Browse structure collections

About this viewer

MolViewer shows 6YJG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.