Glycosylated knob-hole/dummy fc fragment. Determined by X-ray diffraction at 2.05 Å resolution. Released 14 Oct 2020.
Explore 6YSC in 3D Show helices and sheets RCSB PDB PDBe
6YSC contains 19 α-helices and 41 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 239-243 | 5 | 1 |
| α-helix | 247-251 | 5 | |
| β-strand | 258-266 | 9 | 1 |
| β-strand | 274-279 | 6 | 2 |
| β-strand | 282-284 | 3 | 2 |
| β-strand | 288-289 | 2 | 1 |
| α-helix | 290-292 | 3 | |
| β-strand | 293-294 | 2 | 1 |
| β-strand | 300-307 | 8 | 1 |
| α-helix | 310-314 | 5 | |
| β-strand | 319-324 | 6 | 2 |
| β-strand | 332-336 | 5 | 2 |
| α-helix | 339-340 | 2 | |
| β-strand | 344 | 1 | 3 |
| α-helix | 345-346 | 2 | |
| β-strand | 347-351 | 5 | 4 |
| α-helix | 352-354 | 3 | |
| α-helix | 355-357 | 3 | |
| β-strand | 362-372 | 11 | 4 |
| β-strand | 373 | 1 | 3 |
| β-strand | 378-383 | 6 | 5 |
| β-strand | 386-387 | 2 | 5 |
| β-strand | 391-393 | 3 | 4 |
| α-helix | 394-396 | 3 | |
| β-strand | 397-398 | 2 | 4 |
| β-strand | 404-413 | 10 | 4 |
| α-helix | 414-418 | 5 | |
| β-strand | 423-428 | 6 | 5 |
| α-helix | 433-435 | 3 | |
| β-strand | 437-441 | 5 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 239-243 | 5 | 6 |
| α-helix | 244-246 | 3 | |
| α-helix | 247-251 | 5 | |
| β-strand | 258-264 | 7 | 6 |
| β-strand | 276-279 | 4 | 7 |
| β-strand | 282-284 | 3 | 7 |
| β-strand | 288-289 | 2 | 6 |
| β-strand | 293-294 | 2 | 8 |
| β-strand | 300-301 | 2 | 8 |
| β-strand | 302-307 | 6 | 6 |
| α-helix | 310-314 | 5 | |
| β-strand | 319-323 | 5 | 7 |
| α-helix | 331 | 1 | |
| β-strand | 332-336 | 5 | 7 |
| α-helix | 338-340 | 3 | |
| β-strand | 344 | 1 | 9 |
| α-helix | 345-346 | 2 | |
| β-strand | 347-351 | 5 | 10 |
| β-strand | 362-372 | 11 | 10 |
| β-strand | 373 | 1 | 9 |
| β-strand | 378-383 | 6 | 11 |
| β-strand | 386-387 | 2 | 11 |
| β-strand | 391-393 | 3 | 10 |
| α-helix | 394-396 | 3 | |
| β-strand | 397-398 | 2 | 10 |
| β-strand | 404-413 | 10 | 10 |
| α-helix | 414-419 | 6 | |
| β-strand | 423-428 | 6 | 11 |
| α-helix | 433-435 | 3 | |
| β-strand | 437-441 | 5 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Immunoglobulin gamma-1 heavy chain | A | protein | 227 | Homo sapiens | P0DOX5 (AlphaFold model) |
| Immunoglobulin gamma-1 heavy chain | B | protein | 241 | Homo sapiens | P0DOX5 (AlphaFold model) |
>6YSC_1 Immunoglobulin gamma-1 heavy chain (chains A) DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVD GVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK GQPREPQVYTLPPCRDELTKNQVSLWCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDS DGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
>6YSC_2 Immunoglobulin gamma-1 heavy chain (chains B) DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVD GVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK GQPREPQVYTLPPSRDKLTKNQVSLSCAVKGFYPSDIAVEWESNGQPENNYKTTPPVLDS DGSFFLVSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGGGGSHHHHHHHH C
Format chain exchange (FORCE) for high-throughput generation of bispecific antibodies in combinatorial binder-format matrices. Dengl, S., Mayer, K., Bormann, F. et al. Nat Commun (2020) 11:4974-4974. DOI 10.1038/s41467-020-18477-7 · PubMed
Other PDB entries of the same protein (UniProt P0DOX5 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6YSC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.