Closo-carborane butyl-sulfonamide in complex with CA IX mimic. Determined by X-ray diffraction at 0.95 Å resolution. Released 28 Oct 2020.
Explore 6YZN in 3D Show helices and sheets RCSB PDB PDBe
6YZN contains 15 α-helices and 18 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 13-18 | 6 | |
| α-helix | 21-24 | 4 | |
| β-strand | 32-33 | 2 | 1 |
| β-strand | 39-40 | 2 | 2 |
| α-helix | 44-46 | 3 | |
| β-strand | 47-50 | 4 | 2 |
| β-strand | 56-61 | 6 | 2 |
| β-strand | 66-70 | 5 | 2 |
| β-strand | 78-81 | 4 | 2 |
| β-strand | 88-97 | 10 | 2 |
| β-strand | 108-109 | 2 | 1 |
| β-strand | 112 | 1 | 1 |
| α-helix | 113-114 | 2 | |
| β-strand | 116-124 | 9 | 2 |
| α-helix | 125-128 | 3 | |
| α-helix | 131-134 | 4 | |
| β-strand | 141-150 | 10 | 2 |
| α-helix | 155-157 | 3 | |
| α-helix | 158-163 | 6 | |
| α-helix | 164-166 | 3 | |
| β-strand | 173-175 | 3 | 2 |
| α-helix | 181-184 | 4 | |
| β-strand | 191-196 | 6 | 2 |
| β-strand | 207-212 | 6 | 2 |
| α-helix | 215 | 1 | |
| β-strand | 216-218 | 3 | 2 |
| α-helix | 220-226 | 7 | |
| β-strand | 230 | 1 | 3 |
| α-helix | 233 | 1 | |
| α-helix | 237-238 | 2 | |
| β-strand | 240 | 1 | 3 |
| α-helix | 246-248 | 3 | |
| β-strand | 257-258 | 2 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Carbonic anhydrase 2 | A | protein | 260 | Homo sapiens | P00918 (AlphaFold model) |
>6YZN_1 Carbonic anhydrase 2 (chains A) MSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRIL NNGHSFQVTFDDSQDKAVLKGGPLDGTYRLLQFHFHWGSLDGQGSEHTVDKKKYAAELHL VHWNTKYGDVGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTEGKSADFTNFDP RGLLPESLDYWTYPGSLTTPPLAECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELM VDNWRPAQPLKNRQIKASFK
The structural basis for the selectivity of sulfonamido dicarbaboranes toward cancer-associated carbonic anhydrase IX. Kugler, M., Holub, J., Brynda, J. et al. J Enzyme Inhib Med Chem (2020) 35:1800-1810. DOI 10.1080/14756366.2020.1816996 · PubMed
Other PDB entries of the same protein (UniProt P00918 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6YZN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.