Crystal structure of wild type OgpA from Akkermansia muciniphila in P 21 21 21. Determined by X-ray diffraction at 1.65 Å resolution. Released 30 Sept 2020.
Explore 6Z2O in 3D Show helices and sheets RCSB PDB PDBe
6Z2O contains 18 α-helices and 18 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 30-32 | 3 | |
| α-helix | 36-41 | 6 | |
| β-strand | 46-51 | 6 | 1 |
| α-helix | 56-58 | 3 | |
| α-helix | 61-82 | 22 | |
| β-strand | 94-96 | 3 | 2 |
| β-strand | 99-100 | 2 | 2 |
| β-strand | 103-106 | 4 | 1 |
| α-helix | 111-113 | 3 | |
| α-helix | 120-134 | 15 | |
| α-helix | 136-138 | 3 | |
| β-strand | 144-149 | 6 | 1 |
| α-helix | 150-151 | 2 | |
| β-strand | 157 | 1 | 3 |
| β-strand | 160 | 1 | 3 |
| β-strand | 167-169 | 3 | 1 |
| β-strand | 172-177 | 6 | 1 |
| α-helix | 183-185 | 3 | |
| α-helix | 191-210 | 20 | |
| β-strand | 217 | 1 | 4 |
| α-helix | 220-226 | 7 | |
| β-strand | 228-229 | 2 | 5 |
| β-strand | 243-244 | 2 | 5 |
| α-helix | 247-254 | 8 | |
| α-helix | 257-259 | 3 | |
| β-strand | 275-284 | 10 | 4 |
| β-strand | 287-308 | 22 | 4 |
| α-helix | 309 | 1 | |
| α-helix | 311 | 1 | |
| α-helix | 318-320 | 3 | |
| β-strand | 321-339 | 19 | 4 |
| α-helix | 340-342 | 3 | |
| β-strand | 350-359 | 10 | 4 |
| β-strand | 364-372 | 9 | 4 |
| α-helix | 373-375 | 3 | |
| β-strand | 379-380 | 2 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| O-glycan protease | A | protein | 371 | Akkermansia muciniphila ATCC BAA-835 | B2UR60 (AlphaFold model) |
>6Z2O_1 O-glycan protease (chains A) MEVTVPDALKDRIALKKTARQLNIVYFLGSDTEPVPDYERRLSELLLYLQQFYGKEMQRH GYGARSFGLDIKSPGRVNIIEYKAKNPAAHYPYENGGGWKAAQELDEFFKAHPDRKKSQH TLIIMPTWNDEKNGPDNPGGVPFYGMGRNCFALDYPAFDIKHLGQKTREGRLLTKWYGGM AHELGHGLNLPHNHQTASDGKKYGTALMGSGNYTFGTSPTFLTPASCALLDACEVFSVTP SQQFYEGKPEVEVGDVAISFKGDQILVSGNYKSPQTVKALNVYIQDPPYAVNQDYDAVSF SRRLGKKSGKFSMKIDKKELEGLNNNEFRISLMFILANGLHMQKHFTFHWDALQDYRDGS KSGSGHHHHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 1 |
Water and common crystallization additives (EDO) are not listed.
Structural basis of mammalian mucin processing by the human gut O-glycopeptidase OgpA from Akkermansia muciniphila. Trastoy, B., Naegeli, A., Anso, I. et al. Nat Commun (2020) 11:4844-4844. DOI 10.1038/s41467-020-18696-y · PubMed
Other PDB entries of the same protein (UniProt B2UR60 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6Z2O directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.