6ZCO: Nucleoprotein

Crystal Structure of C-terminal Dimerization Domain of Nucleocapsid Phosphoprotein from SARS-CoV-2, crystal form II. Determined by X-ray diffraction at 1.36 Å resolution. Released 1 Jul 2020.

Method: X-ray diffraction
Resolution: 1.36 Å
Organism: Severe acute respiratory syndrome coronavirus 2
Chains: 1
Atoms: 1,119
Mol. weight: 15.12 kDa
Released: 1 Jul 2020

Explore 6ZCO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6ZCO contains 11 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	248-250	3
α-helix	251-256	6
α-helix	259-261	3
β-strand	265	1	1
β-strand	268	1	1
α-helix	270-274	5
β-strand	286	1	2
α-helix	289-294	6
α-helix	295-297	3
α-helix	301-305	5
α-helix	309-310	2
α-helix	311-317	7
β-strand	319-325	7	3
β-strand	328-334	7	3
α-helix	346-356	11
β-strand	357	1	2
α-helix	359-362	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nucleoprotein	A	protein	135	Severe acute respiratory syndrome coronavirus 2	P0DTC9 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6ZCO_1 Nucleoprotein (chains A)
GSSHHHHHHSQDPNSSSTKKSAAEASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQ
ELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQ
VILLNKHIDAYKTFP

Primary citation

High-resolution structure and biophysical characterization of the nucleocapsid phosphoprotein dimerization domain from the Covid-19 severe acute respiratory syndrome coronavirus 2. Zinzula, L., Basquin, J., Bohn, S. et al. Biochem Biophys Res Commun (2021) 538:54-62. DOI 10.1016/j.bbrc.2020.09.131 · PubMed

Other PDB entries of the same protein (UniProt P0DTC9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7LUZ 1.1 Å, GQTVTK segment from the Nucleoprotein of SARS-CoV-2, residues 243-248
7LTU 1.12 Å, Aalall segment from the nucleoprotein of SARS-CoV-2, residues 217-222, crystal form 1
7VBF 1.3 Å, 1.3 Angstrom Resolution Crystal Structure of SARS-CoV-2 Nucleocapsid dimerization…
9F2H 1.3 Å, Crystal structure of SARS-CoV-2 N-protein C-terminal domain in complex with riluzole
7LV2 1.3 Å, GSQASS segment from the Nucleoprotein of SARS-CoV-2, residues 179-184
7LUX 1.3 Å, AALALL segment from the Nucleoprotein of SARS-CoV-2, residues 217-222, crystal form 2
7KGQ 1.34 Å, Crystal Structure of HLA-A*0201in complex with SARS-CoV-2 N222-230
7KGP 1.4 Å, Crystal Structure of HLA-A*0201 in complex with SARS-CoV-2 N316-324
9IN1 1.4 Å, Crystal Structure of C-terminal domain of nucleocapsid protein from SARS-CoV-2
6WZO 1.42 Å, Structure of SARS-CoV-2 Nucleocapsid dimerization domain, P1 form
7N0R 1.42 Å, Structure of the SARS-CoV-2 N protein RNA-binding domain bound to single-domain antibody…
6YUN 1.44 Å, 1.45 Angstrom Resolution Crystal Structure of C-terminal Dimerization Domain of…

Browse structure collections

About this viewer

MolViewer shows 6ZCO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.