6ZCX: SYK Kinase domain

SYK Kinase domain in complex with azabenzimidazole inhibitor 18. Determined by X-ray diffraction at 1.66 Å resolution. Released 23 Jun 2021.

Method: X-ray diffraction
Resolution: 1.66 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,427
Mol. weight: 35.34 kDa
Ligands: QFQ
Released: 23 Jun 2021

Explore 6ZCX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6ZCX contains 15 α-helices and 15 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	364	1	1
α-helix	367-369	3
β-strand	370-372	3	1
β-strand	378	1	1
β-strand	383-391	9	1
β-strand	396-404	9	1
α-helix	414-426	13
β-strand	432	1	2
α-helix	433-434	2
β-strand	435-440	6	1
β-strand	444-449	6	1
β-strand	454-455	2	2
α-helix	456-462	7
α-helix	468-487	20
β-strand	490-491	2	3
α-helix	497-499	3
β-strand	500-504	5	2
β-strand	507-510	4	2
β-strand	517-518	2	3
α-helix	519-520	2
β-strand	526-527	2	4
α-helix	536-538	3
α-helix	541-546	6
β-strand	548-549	2	4
α-helix	551-566	16
α-helix	570-571	2
α-helix	578-586	9
α-helix	591-594	4
α-helix	599-608	10
α-helix	619-637	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tyrosine-protein kinase SYK	A	protein	299	Homo sapiens	P43405 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6ZCX_1 Tyrosine-protein kinase SYK (chains A)
MDTEVYESPYADPEEIRPKEVYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVK
ILKNEANDPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQ
NRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRAD
ENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVT
AMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVNHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
QFQ	~{N},1-dimethyl-5-[[4-[3-methyl-4-[[(3~{R})-piperidin-3-yl]amino]pyrazol-1-yl]p…	C23 H28 N10 O	1

Primary citation

SYK Kinase domain in complex with azabenzimidazole inhibitor 18. Read, J.A. To be published.

Other PDB entries of the same protein (UniProt P43405 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4YJR 1.32 Å, SYK kinase domain in complex with inhibitor GTC000225
4YJQ 1.34 Å, SYK kinase domain in complex with inhibitor GTC000224
4FYO 1.4 Å, Crystal structure of spleen tyrosine kinase complexed with…
5LMA 1.43 Å, Human spleen tyrosine kinase kinase domain in complex with azanaphthyridine inhibitor
3BUW 1.45 Å, Crystal structure of c-Cbl-TKB domain complexed with its binding motif in Syk
6ZCS 1.47 Å, SYK Kinase domain in complex with azabenzimidazole inhibitor 3
5TIU 1.49 Å, Crystal structure of SYK kinase domain with inhibitor
8XQ1 1.5 Å, Crystal structure of spleen tyrosine kinase(SYK) in complex with SKI-G-1673
8BI2 1.51 Å, Syk kinase domain in complex with macrocyclic inhibitor 20a
4YJT 1.52 Å, The kinase domain of human spleen tyrosine (SYK) in complex with GTC000233
1XBB 1.57 Å, Crystal structure of the syk tyrosine kinase domain with Gleevec
4RX8 1.59 Å, SYK Catalytic Domain Complexed with a Potent Triazine Inhibitor2

Browse structure collections

About this viewer

MolViewer shows 6ZCX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.