Keap1 kelch domain bound to a small molecule fragment. Determined by X-ray diffraction at 1.38 Å resolution. Released 14 Apr 2021.
Explore 6ZEW in 3D Show helices and sheets RCSB PDB PDBe
6ZEW contains 7 α-helices and 42 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 327-331 | 5 | 1 |
| β-strand | 334-335 | 2 | 2 |
| β-strand | 337-338 | 2 | 2 |
| β-strand | 342-345 | 4 | 1 |
| β-strand | 352-354 | 3 | 1 |
| α-helix | 356-358 | 3 | |
| β-strand | 363 | 1 | 3 |
| β-strand | 366-370 | 5 | 4 |
| β-strand | 373-377 | 5 | 4 |
| β-strand | 380-383 | 4 | 3 |
| β-strand | 386-389 | 4 | 3 |
| β-strand | 393-397 | 5 | 4 |
| β-strand | 402-405 | 4 | 4 |
| α-helix | 407-409 | 3 | |
| β-strand | 414 | 1 | 5 |
| β-strand | 417-421 | 5 | 6 |
| β-strand | 424-428 | 5 | 6 |
| β-strand | 431-432 | 2 | 5 |
| β-strand | 435-436 | 2 | 5 |
| α-helix | 437 | 1 | |
| β-strand | 440-444 | 5 | 6 |
| β-strand | 449-453 | 5 | 6 |
| α-helix | 454-456 | 3 | |
| β-strand | 461 | 1 | 7 |
| β-strand | 464-468 | 5 | 8 |
| β-strand | 471-475 | 5 | 8 |
| β-strand | 478 | 1 | 7 |
| β-strand | 483 | 1 | 7 |
| β-strand | 487-491 | 5 | 8 |
| α-helix | 492-494 | 3 | |
| β-strand | 496-500 | 5 | 8 |
| α-helix | 501-503 | 3 | |
| β-strand | 508 | 1 | 9 |
| β-strand | 511-515 | 5 | 10 |
| β-strand | 518-522 | 5 | 10 |
| β-strand | 525 | 1 | 9 |
| β-strand | 530 | 1 | 9 |
| β-strand | 534-538 | 5 | 10 |
| β-strand | 543-547 | 5 | 10 |
| α-helix | 548-550 | 3 | |
| β-strand | 555 | 1 | 11 |
| β-strand | 558-562 | 5 | 12 |
| β-strand | 565-569 | 5 | 12 |
| β-strand | 572 | 1 | 11 |
| β-strand | 577 | 1 | 11 |
| β-strand | 580-585 | 6 | 12 |
| β-strand | 590-596 | 7 | 12 |
| β-strand | 602 | 1 | 2 |
| β-strand | 605-609 | 5 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Kelch-like ECH-associated protein 1 | A | protein | 304 | Mus musculus | Q9Z2X8 (AlphaFold model) |
>6ZEW_1 Kelch-like ECH-associated protein 1 (chains A) GPKVGRLIYTAGGYFRQSLSYLEAYNPSNGSWLRLADLQVPRSGLAGCVVGGLLYAVGGR NNSPDGNTDSSALDCYNPMTNQWSPCASMSVPRNRIGVGVIDGHIYAVGGSHGCIHHSSV ERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDGTNRLNSAECYYPERNEWRMI TPMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVETETWTFVAPMRHHRSALGIT VHQGKIYVLGGYDGHTFLDSVECYDPDSDTWSEVTRMTSGRSGVGVAVTMEPCRKQIDQQ NCTC
| ID | Name | Formula | Copies |
|---|---|---|---|
| QHB | 7-methoxy-1~{H}-benzotriazole | C7 H7 N3 O | 1 |
Water and common crystallization additives (SO4, DMS) are not listed.
Deconstructing Noncovalent Kelch-like ECH-Associated Protein 1 (Keap1) Inhibitors into Fragments to Reconstruct New Potent Compounds. Pallesen, J.S., Narayanan, D., Tran, K.T. et al. J Med Chem (2021) 64:4623-4661. DOI 10.1021/acs.jmedchem.0c02094 · PubMed
Other PDB entries of the same protein (UniProt Q9Z2X8 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6ZEW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.