Crystal structure of complex between FH19-20 and FhbA protein from Borrelia hermsii. Determined by X-ray diffraction at 2.2 Å resolution. Released 12 Jan 2022.
Explore 6ZH1 in 3D Show helices and sheets RCSB PDB PDBe
6ZH1 contains 18 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 45-51 | 7 | |
| α-helix | 56-69 | 14 | |
| α-helix | 72-74 | 3 | |
| α-helix | 75-91 | 17 | |
| α-helix | 96-102 | 7 | |
| α-helix | 105-107 | 3 | |
| α-helix | 112-142 | 31 | |
| α-helix | 147-150 | 4 | |
| α-helix | 152-154 | 3 | |
| α-helix | 160-183 | 24 | |
| α-helix | 189-199 | 11 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 1109 | 1 | 1 |
| α-helix | 1112-1114 | 3 | |
| β-strand | 1118-1120 | 3 | 2 |
| α-helix | 1123-1125 | 3 | |
| β-strand | 1128 | 1 | 1 |
| β-strand | 1133-1135 | 3 | 3 |
| β-strand | 1136-1138 | 3 | 2 |
| β-strand | 1143-1145 | 3 | 4 |
| β-strand | 1149-1151 | 3 | 3 |
| β-strand | 1152-1153 | 2 | 5 |
| β-strand | 1156-1157 | 2 | 5 |
| α-helix | 1158-1160 | 3 | |
| β-strand | 1162-1164 | 3 | 4 |
| α-helix | 1165-1166 | 2 | |
| β-strand | 1167-1168 | 2 | 6 |
| α-helix | 1171-1176 | 6 | |
| β-strand | 1179-1181 | 3 | 7 |
| β-strand | 1190-1191 | 2 | 6 |
| β-strand | 1196-1198 | 3 | 8 |
| β-strand | 1199-1201 | 3 | 7 |
| α-helix | 1202 | 1 | |
| β-strand | 1205-1207 | 3 | 9 |
| α-helix | 1210 | 1 | |
| β-strand | 1215-1217 | 3 | 8 |
| β-strand | 1219 | 1 | 10 |
| β-strand | 1222 | 1 | 10 |
| β-strand | 1228-1230 | 3 | 9 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Factor H-binding protein A | A | protein | 186 | Borrelia hermsii YOR | W5SB08 (AlphaFold model) |
| Complement factor H | B | protein | 133 | Homo sapiens | P08603 (AlphaFold model) |
>6ZH1_1 Factor H-binding protein A (chains A) MAHHHHHHVDDDDKDLFNKNKKLDADLLKTLDNLLKTLDNNQKQALIYFKDKLQDKKYLN DLMEQQKSFLDNLQKKKEDPDLQDRLKKTLNSEYDESQFNKLLNELGNAKAKQFLQQLHI MLQSIKDGTLTSFSSSNFNDLQNLEQKKERALQYINGKLYVEYYFYINGISNADNFFETI MEYLKT
>6ZH1_2 Complement factor H (chains B) AGIQNDSTGKCGPPPPIDNGDITSFPLSVYAPASSVEYQCQNLYQLEGNKRITCRNGQWS EPPKCLHPCVISREIMENYNIALRWTAKQKLYSRTGESVEFVCKRGYRLSSRSHTLRTTC WDGKLEYPTCAKR
Mechanism of Borrelia immune evasion by FhbA-related proteins. Kogan, K., Haapasalo, K., Kotila, T. et al. PLoS Pathog (2022) 18:e1010338-e1010338. DOI 10.1371/journal.ppat.1010338 · PubMed
MolViewer shows 6ZH1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.