6ZIU: Bovine ATP synthase stator domain, state 3
bovine ATP synthase stator domain, state 3. Determined by electron microscopy at 6.02 Å resolution. Released 9 Sept 2020.
- Method
- Electron microscopy
- Resolution
- 6.02 Å
- Organism
- Bos taurus
- Chains
- 11
- Atoms
- 9,283
- Mol. weight
- 197.83 kDa
- Released
- 9 Sept 2020
Explore 6ZIU in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
6ZIU contains 57 α-helices and 19 β-strands across 11 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain 8: 5 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 2-4 | 3 | |
| α-helix | 6-17 | 12 | |
| α-helix | 18-24 | 7 | |
| α-helix | 25-29 | 5 | |
| α-helix | 34-37 | 4 | |
Chain a: 12 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| α-helix | 7-9 | 3 | |
| α-helix | 19-25 | 7 | |
| α-helix | 26-30 | 5 | |
| β-strand | 36 | 1 | 1 |
| α-helix | 41-58 | 18 | |
| α-helix | 63-66 | 4 | |
| α-helix | 69-86 | 18 | |
| α-helix | 94-96 | 3 | |
| α-helix | 98-119 | 22 | |
| α-helix | 122-126 | 5 | |
| α-helix | 135-137 | 3 | |
| α-helix | 138-181 | 44 | |
| α-helix | 186-224 | 39 | |
Chain b: 6 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 2-6 | 5 | |
| β-strand | 12-13 | 2 | 3 |
| β-strand | 17-18 | 2 | 3 |
| α-helix | 19-29 | 11 | |
| α-helix | 33-47 | 15 | |
| α-helix | 55-120 | 66 | |
| α-helix | 123-184 | 62 | |
| α-helix | 190-208 | 19 | |
Chain C: 2 helices, 7 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 7-17 | 11 | |
| β-strand | 26 | 1 | 5 |
| β-strand | 28-35 | 8 | 6 |
| β-strand | 38-43 | 6 | 6 |
| α-helix | 47-48 | 2 | |
| β-strand | 51-55 | 5 | 6 |
| β-strand | 60-63 | 4 | 6 |
| β-strand | 70-75 | 6 | 6 |
| β-strand | 87-90 | 4 | 6 |
Chain d: 11 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| α-helix | 12-16 | 5 | |
| α-helix | 24-43 | 20 | |
| α-helix | 53-59 | 7 | |
| α-helix | 65-75 | 11 | |
| α-helix | 89-96 | 8 | |
| α-helix | 97-101 | 5 | |
| α-helix | 104-122 | 19 | |
| α-helix | 125-126 | 2 | |
| α-helix | 127-129 | 3 | |
| β-strand | 131 | 1 | 1 |
| α-helix | 132-138 | 7 | |
| α-helix | 140-142 | 3 | |
Chain e: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 8-41 | 34 | |
Chain f: 4 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| β-strand | 15 | 1 | 2 |
| α-helix | 19-25 | 7 | |
| α-helix | 30-48 | 19 | |
| α-helix | 57-73 | 17 | |
| α-helix | 76-78 | 3 | |
Chain g: 4 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| α-helix | 22-36 | 15 | |
| α-helix | 44-60 | 17 | |
| α-helix | 63-66 | 4 | |
| β-strand | 68 | 1 | 2 |
| α-helix | 69-93 | 25 | |
3 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| ATP synthase protein 8 | 8 | protein | 66 | Bos taurus | P03929 (AlphaFold model) |
| ATP synthase subunit a | a | protein | 226 | Bos taurus | P00847 (AlphaFold model) |
| ATP synthase subunit d, mitochondrial | d | protein | 160 | Bos taurus | P13620 (AlphaFold model) |
| ATP synthase subunit e, mitochondrial | e | protein | 70 | Bos taurus | Q00361 (AlphaFold model) |
| ATP synthase subunit f, mitochondrial | f | protein | 87 | Bos taurus | Q28851 |
| ATP synthase subunit g, mitochondrial | g | protein | 102 | Bos taurus | Q28852 |
| ATP synthase subunit ATP5MPL, mitochondrial | j | protein | 60 | Bos taurus | P14790 |
| ATP synthase F(0) complex subunit B1, mitochondrial | b | protein | 214 | Bos taurus | P13619 |
| ATP synthase-coupling factor 6, mitochondrial | h | protein | 76 | Bos taurus | P02721 |
| ATP synthase subunit O, mitochondrial | S | protein | 190 | Bos taurus | P13621 |
| ATP synthase subunit alpha, mitochondrial | C | protein | 510 | Bos taurus | P19483 |
Sequence of entity 1 (8), FASTA
>6ZIU_1 ATP synthase protein 8 (chains 8)
MPQLDTSTWLTMILSMFLTLFIIFQLKVSKHNFYHNPELTPTKMLKQNTPWETKWTKIYL
PLLLPL
Sequence of entity 2 (a), FASTA
>6ZIU_2 ATP synthase subunit a (chains a)
MNENLFTSFITPVILGLPLVTLIVLFPSLLFPTSNRLVSNRFVTLQQWMLQLVSKQMMSI
HNSKGQTWTLMLMSLILFIGSTNLLGLLPHSFTPTTQLSMNLGMAIPLWAGAVITGFRNK
TKASLAHFLPQGTPTPLIPMLVIIETISLFIQPMALAVRLTANITAGHLLIHLIGGATLA
LMSISTTTALITFTILILLTILEFAVAMIQAYVFTLLVSLYLHDNT
Sequence of entity 3 (d), FASTA
>6ZIU_3 ATP synthase subunit d, mitochondrial (chains d)
AGRKLALKTIDWVAFGEIIPRNQKAVANSLKSWNETLTSRLATLPEKPPAIDWAYYKANV
AKAGLVDDFEKKFNALKVPIPEDKYTAQVDAEEKEDVKSCAEFLTQSKTRIQEYEKELEK
MRNIIPFDQMTIEDLNEVFPETKLDKKKYPYWPHRPIETL
Sequence of entity 4 (e), FASTA
>6ZIU_4 ATP synthase subunit e, mitochondrial (chains e)
VPPVQVSPLIKLGRYSALFLGMAYGAKRYNYLKPRAEEERRLAAEEKKKRDEQKRIEREL
AEAQEDTILK
Sequence of entity 5 (f), FASTA
>6ZIU_5 ATP synthase subunit f, mitochondrial (chains f)
ASVVPLKEKKLLEVKLGELPSWILMRDFTPSGIAGAFQRGYYRYYNKYVNVKKGSIAGLS
MVLAAYVFLNYCRSYKELKHERLRKYH
Sequence of entity 6 (g), FASTA
>6ZIU_6 ATP synthase subunit g, mitochondrial (chains g)
AEFVRNLAEKAPALVNAAVTYSKPRLATFWYYAKVELVPPTPAEIPTAIQSLKKIINSAK
TGSFKQLTVKEALLNGLVATEVWMWFYVGEIIGKRGIIGYDV
Sequence of entity 7 (j), FASTA
>6ZIU_7 ATP synthase subunit ATP5MPL, mitochondrial (chains j)
MLQSLIKKVWIPMKPYYTQAYQEIWVGTGLMAYIVYKIRSADKRSKALKASSAAPAHGHH
Sequence of entity 8 (b), FASTA
>6ZIU_8 ATP synthase F(0) complex subunit B1, mitochondrial (chains b)
PVPPLPEHGGKVRFGLIPEEFFQFLYPKTGVTGPYVLGTGLILYLLSKEIYVITPETFSA
ISTIGFLVYIVKKYGASVGEFADKLNEQKIAQLEEVKQASIKQIQDAIDMEKSQQALVQK
RHYLFDVQRNNIAMALEVTYRERLHRVYREVKNRLDYHISVQNMMRQKEQEHMINWVEKR
VVQSISAQQEKETIAKCIADLKLLSKKAQAQPVM
Sequence of entity 9 (h), FASTA
>6ZIU_9 ATP synthase-coupling factor 6, mitochondrial (chains h)
NKELDPVQKLFVDKIREYRTKRQTSGGPVDAGPEYQQDLDRELFKLKQMYGKADMNTFPN
FTFEDPKFEVVEKPQS
Sequence of entity 10 (S), FASTA
>6ZIU_10 ATP synthase subunit O, mitochondrial (chains S)
FAKLVRPPVQIYGIEGRYATALYSAASKQNKLEQVEKELLRVGQILKEPKMAASLLNPYV
KRSVKVKSLSDMTAKEKFSPLTSNLINLLAENGRLTNTPAVISAFSTMMSVHRGEVPCTV
TTASALDEATLTELKTVLKSFLSKGQVLKLEVKIDPSIMGGMIVRIGEKYVDMSAKTKIQ
KLSRAMREIL
Sequence of entity 11 (C), FASTA
>6ZIU_11 ATP synthase subunit alpha, mitochondrial (chains C)
EKTGTAEVSSILEERILGADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLK
GMSLNLEPDNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGP
IGSKARRRVGLKAPGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAI
DTIINQKRFNDGTDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAA
PLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFY
LHSRLLERAAKMNDAFGGGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKG
IRPAINVGLSVSRVGSAAQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQQLLSR
GVRLTELLKQGQYSPMAIEEQVAVIYAGVRGYLDKLEPSKITKFENAFLSHVISQHQALL
SKIRTDGKISEESDAKLKEIVTNFLAGFEA
Primary citation
Structure of the dimeric ATP synthase from bovine mitochondria. Spikes, T.E., Montgomery, M.G., Walker, J.E. Proc Natl Acad Sci U S A (2020) 117:23519-23526. DOI 10.1073/pnas.2013998117 · PubMed
Other PDB entries of the same protein (UniProt P03929 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 6ZQM 3.29 Å, bovine ATP synthase monomer state 2 (combined)
- 9W2R 3.4 Å, Cryo-EM structure of FoF1-ATPase monomer state 1 on the bovine heart submitochondrial…
- 6ZIT 3.49 Å, bovine ATP synthase Stator domain, state 2
- 6ZBB 3.61 Å, bovine ATP synthase Fo domain
- 6ZPO 4.0 Å, bovine ATP synthase monomer state 1 (combined)
- 6ZQN 4.0 Å, bovine ATP synthase monomer state 3 (combined)
- 9W2S 4.0 Å, Cryo-EM structure of FoF1-ATPase monomer state 3 on the bovine heart submitochondrial…
- 9W2T 4.1 Å, Cryo-EM structure of Fo domain of FoF1-ATPase monomer state on the bovine heart…
- 6ZIQ 4.33 Å, bovine ATP synthase stator domain, state 1
- 9VPB 5.0 Å, Cryo-EM structure of the IF1 bound bovine F-ATP synthase planar dimer
- 9VPC 7.2 Å, Cryo-EM structure of the IF1 bound bovine ATP synthase tetramer
- 7AJF 8.45 Å, bovine ATP synthase dimer state2:state2
Browse structure collections
About this viewer
MolViewer shows 6ZIU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.