6ZPG: Kinesin binding protein

Kinesin binding protein (KBP). Determined by electron microscopy at 4.6 Å resolution. Released 30 Dec 2020.

Method: Electron microscopy
Resolution: 4.6 Å
Organism: Homo sapiens
Chains: 1
Atoms: 3,808
Mol. weight: 71.91 kDa
Released: 30 Dec 2020

Explore 6ZPG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6ZPG contains 20 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 0 β-strands

Element	Residues	Length
α-helix	6-23	18
α-helix	35-50	16
α-helix	88-108	21
α-helix	112-127	16
α-helix	136-152	17
α-helix	155-174	20
α-helix	201-220	20
α-helix	224-239	16
α-helix	249-262	14
α-helix	267-281	15
α-helix	306-329	24
α-helix	393-412	20
α-helix	417-432	16
α-helix	438-454	17
α-helix	455-457	3
α-helix	464-494	31
α-helix	500-522	23
α-helix	541-556	16
α-helix	564-583	20
α-helix	590-606	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
KIF-binding protein	A	protein	621	Homo sapiens	Q96EK5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6ZPG_1 KIF-binding protein (chains A)
MANVPWAEVCEKFQAALALSRVELHKNPEKEPYKSKYSARALLEEVKALLGPAPEDEDER
PEAEDGPGAGDHALGLPAEVVEPEGPVAQRAVRLAVIEFHLGVNHIDTEELSAGEEHLVK
CLRLLRRYRLSHDCISLCIQAQNNLGILWSEREEIETAQAYLESSEALYNQYMKEVGSPP
LDPTERFLPEEEKLTEQERSKRFEKVYTHNLYYLAQVYQHLEMFEKAAHYCHSTLKRQLE
HNAYHPIEWAINAATLSQFYINKLCFMEARHCLSAANVIFGQTGKISATEDTPEAEGEVP
ELYHQRKGEIARCWIKYCLTLMQNAQLSMQDNIGELDLDKQSELRALRKKELDEEESIRK
KAVQFGTGELCDAISAVEEKVSYLRPLDFEEARELFLLGQHYVFEAKEFFQIDGYVTDHI
EVVQDHSALFKVLAFFETDMERRCKMHKRRIAMLEPLTVDLNPQYYLLVNRQIQFEIAHA
YYDMMDLKVAIADRLRDPDSHIVKKINNLNKSALKYYQLFLDSLRDPNKVFPEHIGEDVL
RPAMLAKFRVARLYGKIITADPKKELENLATSLEHYKFIVDYCEKHPEAAQEIEVELELS
KEMVSLLPTKMERFRTKMALT

Primary citation

The mechanism of kinesin inhibition by kinesin-binding protein. Atherton, J., Hummel, J.J., Olieric, N. et al. Elife (2020) 9. DOI 10.7554/eLife.61481 · PubMed

Other PDB entries of the same protein (UniProt Q96EK5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7RSQ 3.8 Å, Cryo-EM structure of KIFBP core
7RYQ 4.6 Å, Cryo-EM map of KIFBP
7RYP 4.8 Å, Cryo-EM structure of KIFBP:KIF15
7RSI 4.9 Å, The cryo-EM map of KIF18A bound to KIFBP
6ZPH 6.9 Å, Kinesin binding protein complexed with Kif15 motor domain

Browse structure collections

About this viewer

MolViewer shows 6ZPG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.