6ZSH: EH domain-binding protein 1

The mechanism of activation of the actin binding protein EHBP1 by Rab8 family members. Determined by X-ray diffraction at 2.2 Å resolution. Released 2 Sept 2020.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,320
Mol. weight: 51.36 kDa
Released: 2 Sept 2020

Explore 6ZSH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6ZSH contains 21 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	1072-1105	34
α-helix	1109-1160	52

Chain B: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	445-456	12
α-helix	470-472	3
α-helix	476-485	10
α-helix	487-489	3
α-helix	500-513	14
α-helix	516-518	3
α-helix	522-528	7
α-helix	529-532	4
α-helix	533-547	15

Chain C: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	1073-1105	33
α-helix	1109-1150	42

Chain D: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	445-456	12
α-helix	470-472	3
α-helix	476-485	10
α-helix	487-489	3
α-helix	500-513	14
α-helix	516-518	3
α-helix	522-527	6
α-helix	533-546	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
EH domain-binding protein 1	A, C	protein	106	Homo sapiens	Q8NDI1 (AlphaFold model)
EH domain-binding protein 1	B, D	protein	114	Homo sapiens	Q8NDI1 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>6ZSH_1 EH domain-binding protein 1 (chains A, C)
GHMDEVLNKGFKDTSQYVVGELAALENEQKQIDTRAALVEKRLRYLMDTGRNTEEEEAMM
QEWFMLVNKKNALIRRMNQLSLLEKEHDLERRYELLNRELRAMLAI

Sequence of entity 2 (B, D), FASTA

>6ZSH_2 EH domain-binding protein 1 (chains B, D)
GHMGRKPNASQSLLVWCKEVTKNYRGVKITNFTTSWRNGLSFCAILHHFRPDLIDYKSLN
PQDIKENNKKAYDGFASIGISRLLEPSDMVLLAIPDKLTVMTYLYQIRAHFSGQ

Primary citation

The mechanism of activation of the actin binding protein EHBP1 by Rab8 family members. Rai, A., Bleimling, N., Vetter, I.R. et al. Nat Commun (2020) 11:4187-4187. DOI 10.1038/s41467-020-17792-3 · PubMed

Other PDB entries of the same protein (UniProt Q8NDI1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6ZSI 1.91 Å, The mechanism of activation of the actin binding protein EHBP1 by Rab8 family members.
6ZSJ 2.0 Å, The mechanism of activation of the actin binding protein EHBP1 by Rab8 family members.
2D89 Solution structure of the CH domain from human EH domain binding protein 1

Browse structure collections

About this viewer

MolViewer shows 6ZSH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.