Botulinum neurotoxin B2 binding domain in complex with GD1a. Determined by X-ray diffraction at 1.8 Å resolution. Released 14 Oct 2020.
Explore 6ZVM in 3D Show helices and sheets RCSB PDB PDBe
6ZVM contains 9 α-helices and 44 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 858-861 | 4 | |
| β-strand | 864-867 | 4 | 1 |
| β-strand | 868-870 | 3 | 2 |
| β-strand | 875-877 | 3 | 2 |
| β-strand | 884-887 | 4 | 3 |
| β-strand | 892-893 | 2 | 1 |
| β-strand | 898-902 | 5 | 1 |
| β-strand | 909-912 | 4 | 3 |
| α-helix | 920-923 | 4 | |
| β-strand | 926-933 | 8 | 1 |
| α-helix | 935-938 | 4 | |
| α-helix | 942-947 | 6 | |
| β-strand | 949-957 | 9 | 3 |
| β-strand | 960-967 | 8 | 3 |
| β-strand | 970-976 | 7 | 3 |
| β-strand | 982-988 | 7 | 3 |
| β-strand | 1003-1009 | 7 | 1 |
| β-strand | 1013-1018 | 6 | 1 |
| β-strand | 1021-1027 | 7 | 1 |
| β-strand | 1040-1046 | 7 | 3 |
| β-strand | 1053-1062 | 10 | 1 |
| α-helix | 1068-1079 | 12 | |
| β-strand | 1083 | 1 | 4 |
| β-strand | 1085 | 1 | 5 |
| β-strand | 1091 | 1 | 5 |
| α-helix | 1092 | 1 | |
| β-strand | 1093 | 1 | 6 |
| β-strand | 1097-1098 | 2 | 7 |
| β-strand | 1099-1102 | 4 | 8 |
| β-strand | 1108-1112 | 5 | 7 |
| α-helix | 1113 | 1 | |
| β-strand | 1119-1123 | 5 | 7 |
| α-helix | 1124-1125 | 2 | |
| β-strand | 1126 | 1 | 9 |
| β-strand | 1137 | 1 | 9 |
| β-strand | 1145-1149 | 5 | 7 |
| β-strand | 1160 | 1 | 6 |
| β-strand | 1162 | 1 | 4 |
| β-strand | 1166-1173 | 8 | 7 |
| β-strand | 1176-1181 | 6 | 7 |
| β-strand | 1182-1183 | 2 | 10 |
| β-strand | 1190-1192 | 3 | 7 |
| β-strand | 1194-1197 | 4 | 7 |
| β-strand | 1204-1205 | 2 | 10 |
| β-strand | 1207-1211 | 5 | 7 |
| β-strand | 1221 | 1 | 8 |
| β-strand | 1222-1226 | 5 | 7 |
| β-strand | 1236-1244 | 9 | 7 |
| β-strand | 1253-1260 | 8 | 7 |
| α-helix | 1262-1266 | 5 | |
| β-strand | 1280-1283 | 4 | 8 |
| β-strand | 1286 | 1 | 11 |
| β-strand | 1289 | 1 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Neurotoxin | AAA | protein | 438 | Clostridium botulinum | Q8GR96 |
>6ZVM_1 Neurotoxin (chains AAA) SHMNSEILNNIILNLRYRDNNLIDLSGYGANVEVYDGVELNDKNQFKLTSSTNSEIRVTQ NQNIIFNSMFLDFSVSFWIRIPKYKNDGIQNYIHNEYTIINCIKNNSGWKISIRGNRIIW TLTDINGKTKSVFFEYSIREDISDYINRWFFVTITNNSDNAKIYINGKLESNIDIKDIGE VIANGEIIFKLDGDIDRTQFIWMKYFSIFNTELSQSNIKEIYKIQSYSEYLKDFWGNPLM YNKEYYMFNAGNKNSYIKLKKDSSVGEILTRSKYNQNSNYINYRNLYIGEKFIIRRKSNS QSINDDIVRKEDYIYLDFFNSNREWRVYAYKDFKEEEKKLFLANIYDSNEFYKTIQIKEY DEQPTYSCQLLFKKDEESTDEIGLIGIHRFYESGIVLKDYKNYFCISKWYLKEVKRKPYN PNLGCNWQFIPKDEGWIE
Structural and Biochemical Characterization of Botulinum Neurotoxin Subtype B2 Binding to Its Receptors. Davies, J.R., Masuyer, G., Stenmark, P. Toxins (Basel) (2020) 12. DOI 10.3390/toxins12090603 · PubMed
Other PDB entries of the same protein (UniProt Q8GR96), best resolution first:
MolViewer shows 6ZVM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.