Crystal structure of the Fyn SH3 domain A95S-D99T mutant in C21 space group. Determined by X-ray diffraction at 1.5 Å resolution. Released 25 Aug 2021.
Explore 7A2M in 3D Show helices and sheets RCSB PDB PDBe
7A2M contains 3 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 86-89 | 4 | 1 |
| β-strand | 93 | 1 | 2 |
| β-strand | 100 | 1 | 1 |
| α-helix | 101-102 | 2 | |
| β-strand | 103 | 1 | 2 |
| β-strand | 108-113 | 6 | 1 |
| β-strand | 119-124 | 6 | 1 |
| β-strand | 130-134 | 5 | 1 |
| α-helix | 135-137 | 3 | |
| β-strand | 138-140 | 3 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 86-89 | 4 | 3 |
| β-strand | 93 | 1 | 4 |
| β-strand | 100 | 1 | 3 |
| β-strand | 103 | 1 | 4 |
| β-strand | 108-110 | 3 | 3 |
| β-strand | 119-124 | 6 | 3 |
| β-strand | 130-134 | 5 | 3 |
| α-helix | 135-137 | 3 | |
| β-strand | 138-140 | 3 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Tyrosine-protein kinase Fyn | A, B | protein | 60 | Homo sapiens | P06241 (AlphaFold model) |
>7A2M_1 Tyrosine-protein kinase Fyn (chains A, B) GVTLFVALYDYESRTETDLSFHKGEKFQILNSSEGDWWEARSLTTGETGYIPSNYVAPVD
Crystal structure of the Fyn SH3 domain A95S-D99T mutant in C21 space group. Camara-Artigas, A., Plaza-Garrido, M., Salinas-Garcia, M.C. To be published.
Other PDB entries of the same protein (UniProt P06241 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7A2M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.