ENAH EVH1 in complex with Ac-[2-Cl-F]-[ProM-2]-[ProM-17]-OMe. Determined by X-ray diffraction at 0.78 Å resolution. Released 7 Oct 2020.
Explore 7A5M in 3D Show helices and sheets RCSB PDB PDBe
7A5M contains 2 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-17 | 15 | 1 |
| β-strand | 22-25 | 4 | 1 |
| α-helix | 26-28 | 3 | |
| β-strand | 32-40 | 9 | 1 |
| β-strand | 45-52 | 8 | 1 |
| β-strand | 58-63 | 6 | 1 |
| β-strand | 70-72 | 3 | 1 |
| β-strand | 77-81 | 5 | 1 |
| β-strand | 86-91 | 6 | 1 |
| α-helix | 94-110 | 17 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protein enabled homolog | A | protein | 113 | Homo sapiens | Q8N8S7 (AlphaFold model) |
| Ac-[2-Cl-F]-[ProM-2]-[ProM-17]-OMe | B, C | protein | 4 | synthetic construct |
>7A5M_1 Protein enabled homolog (chains A) GSMSEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRKIQDHQV VINCAIPKGLKYNQATQTFHQWRDARQVYGLNFGSKEDANVFASAMMHALEVL
>7A5M_2 Ac-[2-Cl-F]-[ProM-2]-[ProM-17]-OMe (chains B, C) XXXX
Designed nanomolar small-molecule inhibitors of Ena/VASP EVH1 interaction impair invasion and extravasation of breast cancer cells. Barone, M., Muller, M., Chiha, S. et al. Proc Natl Acad Sci U S A (2020) 117:29684-29690. DOI 10.1073/pnas.2007213117 · PubMed
Other PDB entries of the same protein (UniProt Q8N8S7 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7A5M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.