7AEO: Human ARTD2

Human ARTD2 in complex with DNA oligonucleotides. Determined by X-ray diffraction at 2.8 Å resolution. Released 19 May 2021.

Method: X-ray diffraction
Resolution: 2.8 Å
Organisms: Homo sapiens, synthetic construct
Chains: 3
Atoms: 4,270
Mol. weight: 66.71 kDa
Released: 19 May 2021

Explore 7AEO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7AEO contains 25 α-helices and 29 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 25 helices, 29 β-strands

Element	Residues	Length	Sheet
α-helix	92-94	3
β-strand	105-107	3	1
β-strand	109-110	2	2
β-strand	113-114	2	2
β-strand	116-123	8	1
α-helix	124-126	3
β-strand	128-139	12	1
β-strand	145-153	9	1
β-strand	159-166	8	1
α-helix	169-184	16
α-helix	196-197	2
α-helix	201	1
β-strand	202-204	3	1
β-strand	206	1	3
α-helix	236-245	10
α-helix	248-259	12
α-helix	262-264	3
α-helix	269	1
β-strand	270	1	3
α-helix	271	1
α-helix	272-290	19
α-helix	297-308	12
β-strand	313	1	4
β-strand	315	1	4
α-helix	317-320	4
α-helix	324-335	12
α-helix	357-365	9
β-strand	367-368	2	5
β-strand	371	1	6
α-helix	377-388	12
β-strand	397-406	10	6
β-strand	408-409	2	5
α-helix	412-415	4
β-strand	423-429	7	6
α-helix	432-434	3
α-helix	435-441	7
β-strand	461-463	3	7
β-strand	464	1	6
α-helix	467-471	5
α-helix	472-474	3
β-strand	484-491	8	6
β-strand	495-498	4	7
α-helix	505-509	5
β-strand	514-517	4	7
β-strand	519-523	5	8
α-helix	525-527	3
β-strand	529-531	3	6
β-strand	534-536	3	6
β-strand	541-543	3	8
α-helix	552-553	2
β-strand	554-556	3	8
β-strand	558-561	4	7
α-helix	564-566	3
β-strand	567-579	13	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Poly [ADP-ribose] polymerase 2	A	protein	496	Homo sapiens	Q9UGN5 (AlphaFold model)
DNA	B	DNA	16	synthetic construct
DNA	C	DNA	16	synthetic construct

Sequence of entity 1 (A), FASTA

>7AEO_1 Poly [ADP-ribose] polymerase 2 (chains A)
SMGKAPVDPECTAKVGKAHVYCEGNDVYDVMLNQTNLQFNNNKYYLIQLLEDDAQRNFSV
WMRWGRVGKMGQHSLVACSGNLNKAKEIFQKKFLDKTKNNWEDREKFEKVPGKYDMLQMD
YATNTQDEEETKKEESLKSPLKPESQLDLRVQELIKLICNVQAMEEMMMEMKYNTKKAPL
GKLTVAQIKAGYQSLKKIEDCIRAGQHGRALMEACNEFYTRIPHDFGLRTPPLIRTQKEL
SEKIQLLEALGDIEIAIKLVKTELQSPEHPLDQHYRNLHCALRPLDHESYEFKVISQYLQ
STHAPTHSDYTMTLLDLFEVEKDGEKEAFREDLHNRMLLWHGSRMSNWVGILSHGLRIAP
PEAPITGYMFGKGIYFADMSSKSANYCFASRLKNTGLLLLSEVALGQCNELLEANPKAEG
LLQGKHSTKGLGKMAPSSAHFVTLNGSTVPLGPASDTGILNPDGYTLNYNEYIVYNPNQV
RMRYLLKVQFNFLQLW

Sequence of entity 2 (B), FASTA

>7AEO_2 DNA (chains B)
TGTGCTCCGGGTCGTC

Sequence of entity 3 (C), FASTA

>7AEO_3 DNA (chains C)
GACGACCCGGAGCACA

Primary citation

Activation of PARP2/ARTD2 by DNA damage induces conformational changes relieving enzyme autoinhibition. Obaji, E., Maksimainen, M.M., Galera-Prat, A. et al. Nat Commun (2021) 12:3479-3479. DOI 10.1038/s41467-021-23800-x · PubMed

Other PDB entries of the same protein (UniProt Q9UGN5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4ZZX 1.65 Å, Structure of PARP2 catalytic domain bound to an isoindolinone inhibitor
5D5K 1.9 Å, Crystal Structure NLS from human PARP-2 complexed with Importin alpha delta IBB
3KJD 1.95 Å, Human poly(ADP-ribose) polymerase 2, catalytic fragment in complex with an inhibitor…
3KCZ 2.0 Å, Human poly(ADP-ribose) polymerase 2, catalytic fragment in complex with an inhibitor…
7R59 2.0 Å, PARP2 catalytic domain in complex with OUL245
4TVJ 2.1 Å, Human ARTD2 (PARP2) - catalytic domain in complex with olaparib
8HKO 2.1 Å, Mutated human ADP-ribosyltransferase 2 (PARP2) catalytic domain bound to Rucaparib
9IM8 2.1 Å, Mutated ADP-ribosyltransferase 2 (PARP2) catalytic domain bound to a pyrimidine…
9ZQB 2.1 Å, Nucleosome with an SSB at SHL -2.8 in complex with human PARP2 and HPF1, Class 1
4ZZY 2.2 Å, Structure of human PARP2 catalytic domain bound to an isoindolinone inhibitor
6F1K 2.2 Å, Structure of ARTD2/PARP2 WGR domain bound to double strand DNA without 5'phosphate
8HLJ 2.24 Å, Mutated human ADP-ribosyltransferase 2 (PARP2) catalytic domain bound to Olaparib…

Browse structure collections

About this viewer

MolViewer shows 7AEO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.